Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GNVKKLGDTYPSISNARNAELRLRWGQIVLKNDHQEDFWKVKEFLHNQGK QKYTLPLYHAMMGGSEVAQTLAKETFASTASQLHSNVVNYVQQIVAPKGS
    • Molecular weight
      37 kDa including tags
    • Amino acids
      551 to 650

Specifications

Our Abpromise guarantee covers the use of ab114879 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Aminopeptidase B
    • AMPB_HUMAN
    • Ap B
    • AP-B
    • APB
    • Arginine aminopeptidase
    • Arginyl aminopeptidase
    • Arginyl aminopeptidase (aminopeptidase B)
    • DKFZp547H084
    • RNPEP
    see all
  • Function
    Exopeptidase which selectively removes arginine and/or lysine residues from the N-terminus of several peptide substrates including Arg(0)-Leu-enkephalin, Arg(0)-Met-enkephalin and Arg(-1)-Lys(0)-somatostatin-14. Can hydrolyze leukotriene A4 (LTA-4) into leukotriene B4 (LTB-4).
  • Sequence similarities
    Belongs to the peptidase M1 family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Recombinant Human RNPEP protein images

  • 12.5% SDS-PAGE showing ab114879 at approximately 36.63kDa.
    Stained with Coomassie Blue.

References for Recombinant Human RNPEP protein (ab114879)

ab114879 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114879.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up