Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASMTGGQQMGRGEFMDLSGVKKKSLLGVKENNKKSSTRAPSPTKRKDRS DEKSKDRSKDKGATKESSEKDRGRDKTRKRRSASSGSSSTRSRSSSTSSS GSSTSTGSSSGSSSSSASSRSGSSSTSRSSSSSSSSGSPSPSRRRHDNRR RSRSKSKPPKRDEKERKRRSPSPKPTKVHIGRLTRNVTKDHIMEIFSTYG KIKMIDMPVERMHPHLSKGYAYVEFENPDEAEKALKHMDGGQIDGQEITA TAVLAPWPRPPPRRFSPPRRMLPPPPMWRRSPPRMRRRSRSPRRRSPVRR RSRSPGRRRHRSRSSSNSSR
    • Molecular weight
      36 kDa
    • Amino acids
      1 to 305
    • Tags
      T7 tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab169913 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.
    ab169913 was expressed in E.coli as inclusion bodies. The final product was refolded and chromatographically purified.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituent: 0.32% Tris HCl
    Note: Contains NaCl, KCl, EDTA, arginine, DTT and glycerol.

General Info

  • Alternative names
    • E5.1
    • MGC117332
    • RNA binding protein S1 serine rich domain
    • RNA binding protein with serine rich domain 1
    • RNA-binding protein with serine-rich domain 1
    • RNPS 1
    • rnps1
    • RNPS1_HUMAN
    • SR protein
    • SR related protein LDC2
    • SR-related protein LDC2
    see all
  • Function
    Component of a splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junction on mRNAs. The EJC is a dynamic structure consisting of a few core proteins and several more peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. Part of pre- and post-splicing multiprotein mRNP complexes. Enhances the formation of the ATP-dependent A complex of the spliceosome. Involved in both constitutive splicing and, in association with SRP54 and TRA2B/SFRS10, in distinctive modulation of alternative splicing in a substrate-dependent manner. Participates in mRNA 3'-end cleavage. Involved in UPF2-dependent nonsense-mediated decay (NMD) of mRNAs containing premature stop codons. Also mediates increase of mRNA abundance and translational efficiency. Binds spliced mRNA 20-25 nt upstream of exon-exon junctions.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the splicing factor SR family.
    Contains 1 RRM (RNA recognition motif) domain.
  • Post-translational
    modifications
    Phosphorylated on one or more of the four Ser/Thr residues (Ser-43, Thr-49, Ser-52 or Ser-53). Ser-53 phosphorylation site is important for splicing and translation stimulation activity in vitro.
  • Cellular localization
    Nucleus. Nucleus speckle. Cytoplasm. Nucleocytoplasmic shuttling protein. Colocalizes with the core EJC, ALYREF/THOC4, NXF1 and UAP56 in the nucleus and nuclear speckles.
  • Information by UniProt

References

ab169913 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169913.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up