Recombinant Human robld3 protein (ab101637)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSHMLRPKALTQVLSQANTGGVQSTLLLN NEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFNEDNLKFILMDC MEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEPLTQVAAS
    • Molecular weight
      16 kDa including tags
    • Amino acids
      1 to 125
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101637 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab101637 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0

General Info

  • Alternative names
    • ENDAP
    • Endosomal adaptor protein p14
    • HSPC003
    • LAMTOR2
    • Late endosomal/lysosomal adaptor and MAPK and MTOR activator 2
    • Late endosomal/lysosomal Mp1 interacting protein
    • Late endosomal/lysosomal Mp1-interacting protein
    • LTOR2_HUMAN
    • MAPBPIP
    • MAPKSP1 adaptor protein
    • MAPKSP1AP
    • Mitogen activated protein binding protein interacting protein
    • Mitogen-activated protein-binding protein-interacting protein
    • p14
    • Ragulator complex protein LAMTOR2
    • Ragulator2
    • Roadblock domain containing 3
    • Roadblock domain containing protein 3
    • Roadblock domain-containing protein 3
    • ROBLD 3
    • RP11 336K24.9
    see all
  • Function
    As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator functions as a guanine nucleotide exchange factor activating the small GTPases Rag. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. Adapter protein that enhances the efficiency of the MAP kinase cascade facilitating the activation of MAPK2.
  • Involvement in disease
    Defects in LAMTOR2 are the cause of immunodeficiency due to defect in MAPBP-interacting protein (ID-MAPBPIP) [MIM:610798]. This form of primary immunodeficiency syndrome includes congenital neutropenia, partial albinism, short stature and B-cell and cytotoxic T-cell deficiency.
  • Sequence similarities
    Belongs to the GAMAD family.
  • Cellular localization
    Late endosome membrane. Lysosome membrane.
  • Information by UniProt

Images

  • ab101637 (3 µg) analyzed by 15% SDS PAGE.

References

ab101637 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101637.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up