Recombinant Human robld3 protein (ab101637)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9Y2Q5
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSHMLRPKALTQVLSQANTGGVQSTLLLN NEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFNEDNLKFILMDC MEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEPLTQVAAS
    • Molecular weight16 kDa including tags
    • Amino acids1 to 125
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101637 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab101637 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0

General Info

  • Alternative names
    • ENDAP
    • Endosomal adaptor protein p14
    • HSPC003
    • LAMTOR2
    • Late endosomal/lysosomal adaptor and MAPK and MTOR activator 2
    • Late endosomal/lysosomal Mp1 interacting protein
    • Late endosomal/lysosomal Mp1-interacting protein
    • LTOR2_HUMAN
    • MAPBPIP
    • MAPKSP1 adaptor protein
    • MAPKSP1AP
    • Mitogen activated protein binding protein interacting protein
    • Mitogen-activated protein-binding protein-interacting protein
    • p14
    • Ragulator complex protein LAMTOR2
    • Ragulator2
    • Roadblock domain containing 3
    • Roadblock domain containing protein 3
    • Roadblock domain-containing protein 3
    • ROBLD 3
    • RP11 336K24.9
    see all
  • FunctionAs part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator functions as a guanine nucleotide exchange factor activating the small GTPases Rag. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. Adapter protein that enhances the efficiency of the MAP kinase cascade facilitating the activation of MAPK2.
  • Involvement in diseaseDefects in LAMTOR2 are the cause of immunodeficiency due to defect in MAPBP-interacting protein (ID-MAPBPIP) [MIM:610798]. This form of primary immunodeficiency syndrome includes congenital neutropenia, partial albinism, short stature and B-cell and cytotoxic T-cell deficiency.
  • Sequence similaritiesBelongs to the GAMAD family.
  • Cellular localizationLate endosome membrane. Lysosome membrane.
  • Information by UniProt

Recombinant Human robld3 protein images

  • ab101637 (3 µg) analyzed by 15% SDS PAGE.

References for Recombinant Human robld3 protein (ab101637)

ab101637 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101637.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"