Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDASPSPFSLPKKLNELSARRGSDELLSSGIINGPFTMNSSTPSTANGND SKKFKRDRPPCSPSRVLHLRKIPCDVTEAEIISLGLPFGKVTNLLMLKGK SQAFLEMASEEAAVTMVNYYTPITPHLRSQPVYIQYSNHRELKTDNLPNQ ARAQAALQAVSAVQSGSLALSGGPSNEGTVLPGQSPVLRIIIENLFYPVT LEVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPVNAHYAKMALDGQNI YNACCTLRIDFSKLTSLNVKYNNDKSRDFTRLDLPTGDGQPSLEPPMAAA FGAPGIISSPYAGAAGFAPAIGFPQATGLSVPAVPGALGPLTITSSAVTG RMAIPGASGIPGNSVLLVTNLNPDLITPHGLFILFGVYGDVHRVKIMFNK KENALVQMADANQAQLAMNHLSGQRLYGKVLRATLSKHQAVQLPREGQED QGLTKDFSNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVTVDDLKNL FIEAGCSVKAFKFFQKDRKMALIQLGSVEEAIQALIELHNHDLGENHHLR VSFSKSTI
    • Amino acids
      1 to 558
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160750 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp781I1117
    • Fission yeast differentiation regulator
    • OTTHUMP00000021931
    • OTTHUMP00000021932
    • Polypyrimidine tract binding protein 3
    • regulator of differentiation 1
    • Regulator of differentiation (in S. pombe) 1
    • Regulator of differentiation 1
    • ROD 1
    • Rod1
    • ROD1 regulator of differentiation 1
    • ROD1_HUMAN
    see all
  • Function
    May play a role in regulation of differentiation. In vitro, binds RNA, preferentially to both poly(G) and poly(U). Overexpressed, blocks differentiation of K562 leukemia cells following treatment with phorbol esters or sodium butyrate without affecting proliferation.
  • Tissue specificity
    Expressed in several hematopoietic cell lines examined.
  • Sequence similarities
    Contains 4 RRM (RNA recognition motif) domains.
  • Information by UniProt

Images

  • ab160750 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160750 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160750.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up