Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ03395
    • SpeciesHuman
    • SequenceQLRYHCCGRHGYKDWFGVQWVSSRYLDPGDRDVADRIQSNVEGLYLTDGV PFSCCNPHSPRPCLQNRLSDSYAHPLFDPRQPNQNLWAQGCHEVLLEHLQ DL
    • Molecular weight37 kDa including tags
    • Amino acids163 to 264

Specifications

Our Abpromise guarantee covers the use of ab116995 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Retinal outer segment membrane protein 1
    • Rod outer segment membrane protein 1
    • ROM
    • ROM1
    • ROM1_HUMAN
    • ROSP1
    • RP7
    • Tetraspanin 23
    • Tetraspanin-23
    • Tspan 23
    • Tspan-23
    • TSPAN23
    see all
  • FunctionMay function as an adhesion molecule involved in stabilization and compaction of outer segment disks or in the maintenance of the curvature of the rim. It is essential for disk morphogenesis.
  • Tissue specificityRetina (photoreceptor). In rim region of ROS (rod outer segment) disks.
  • Involvement in diseaseDefects in ROM1 may cause retinitis pigmentosa (RP) [MIM:268000]; when associated with defects in PRPH2.
  • Sequence similaritiesBelongs to the PRPH2/ROM1 family.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human ROM1 protein images

  • 12.5% SDS-PAGE showing ab116995 at approx. 36.85 kDa.
    Stained with Coomassie Blue.

References for Recombinant Human ROM1 protein (ab116995)

ab116995 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116995.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"