Overview

  • Product name
    Recombinant Human ROPN1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVC EVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEICASHVSRMLNYIEQEVI GPDGLITVNDFTQNPRVWLE
    • Amino acids
      1 to 120
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162834 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cancer/testis antigen 91
    • CT 91
    • CT91
    • DKFZp434B1222
    • ODF 6
    • ODF6
    • Outer dense fiber of sperm tails 6
    • Rhophilin associated protein 1A
    • RHPNAP 1
    • RHPNAP1
    • ROPN 1
    • ROPN 1A
    • ROPN1A
    • Ropporin
    • Ropporin 1A
    • Ropporin rhophilin associated protein 1
    • Ropporin1A
    see all
  • Relevance
    ROPN1 (Ropporin) is a sperm-specific binding protein of rhophilin and is localized in the fibrous sheath of sperm flagella. It is overexpressed in hematologic tumor cells.
  • Cellular localization
    Note=In the sperm tail, found in the principal piece and in the cytoplasmic droplet located at the distal end of the midpiece. Inner surface of the fibrous sheath.

Images

  • ab162834 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162834 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162834.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up