Recombinant Human ROR beta protein (ab114845)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ92753
    • SpeciesHuman
    • SequenceMRAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNASYSCPRQR NCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLYAEVQKH QQRLQEQRQQQSGEAEALARVYSSSISNGLSNLNNETSGTYANGHVIDLP KSEGYYNVDSGQPSPDQSGLDMTGIKQIKQEPIYDLTSVPNLFTYSSFNN GQLAPGITMTEIDRIAQNIIKSHLETCQYTMEELHQLAWQTHTYEEIKAY QSKSREALWQQCAIQITHAIQYVVEFAKRITGFMELCQNDQILLLKSGCL EVVLVRMCRAFNPLNNTVLFEGKYGGMQMFKALGSDDLVNEAFDFAKNLC SLQLTEEEIALFSSAVLISPDRAWLIEPRKVQKLQEKIYFALQHVIQKNH LDDETLAKLIAKIPTITAVCNLHGEKLQVFKQSHPEIVNTLFPPLYKELF NPDCATGCK
    • Molecular weight77 kDa including tags
    • Amino acids1 to 459

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114845 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bA133M9.1
    • NR1F2
    • Nuclear receptor ROR-beta
    • Nuclear receptor RZR beta
    • Nuclear receptor RZR-beta
    • Nuclear receptor subfamily 1 group F member 2
    • OTTHUMP00000021486
    • RAR related orphan receptor B
    • RAR related orphan receptor beta
    • Retinoic acid binding receptor beta
    • Retinoid-related orphan receptor-beta
    • ROR BETA
    • Rorb
    • RORB_HUMAN
    • RZR BETA
    • RZRB
    see all
  • FunctionOrphan nuclear receptor required for normal postnatal development of rod and cone photoreceptor cells. Regulates transcription of OPN1SW in cone photoreceptor cells by binding the sequence 5'-AGGTCA-3' in the OPN1SW promoter.
  • Sequence similaritiesBelongs to the nuclear hormone receptor family. NR1 subfamily.
    Contains 1 nuclear receptor DNA-binding domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human ROR beta protein images

  • ab114845 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References for Recombinant Human ROR beta protein (ab114845)

ab114845 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114845.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"