Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      ANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPH THTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACGK
    • Molecular weight
      37 kDa including tags
    • Amino acids
      294 to 393

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114633 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • dJ537F10.1
    • Inactive tyrosine protein kinase transmembrane receptor ROR1
    • MGC99659
    • Neurotrophic tyrosine kinase
    • Neurotrophic tyrosine kinase receptor related 1
    • Neurotrophic tyrosine kinase, receptor related 1
    • NTRKR1
    • OTTHUMP00000010573
    • OTTHUMP00000010574
    • OTTMUSP00000008344
    • Receptor tyrosine kinase like orphan receptor 1
    • receptor-related 1
    • RGD1559469
    • ROR 1
    • ROR1
    • ROR1_HUMAN
    • RP11 24J23.1
    • Tyrosine kinase like orphan receptor 1
    • Tyrosine protein kinase transmembrane receptor ROR1
    • Tyrosine-protein kinase transmembrane receptor ROR1
    see all
  • Function
    Tyrosine-protein kinase receptor whose role is not yet clear.
  • Tissue specificity
    Expressed strongly in human heart, lung and kidney, but weakly in the CNS. Isoform Short is strongly expressed in fetal and adult CNS and in a variety of human cancers, including those originating from CNS or PNS neuroectoderm.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Tyr protein kinase family. ROR subfamily.
    Contains 1 FZ (frizzled) domain.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 kringle domain.
    Contains 1 protein kinase domain.
  • Developmental stage
    Expressed at high levels during early embryonic development. The expression levels drop strongly around day 16 and there are only very low levels in adult tissues.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab114633 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References

ab114633 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114633.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up