Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      EVEVLDPNDPLGPLDGQDGPIPTLKGYFLNFLEPVNNITIVQGQTAILHC KVAGNPPPNVRWLKNDAPVVQEPRRIIIRKTEYGSRLRIQDLDTTDTGYY QCVATNGMKT
    • Amino acids
      34 to 143
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159018 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BDB
    • BDB1
    • Brachydactyly type B
    • EC 2.7.10.1
    • MGC163394
    • Neurotrophic tyrosine kinase
    • Neurotrophic tyrosine kinase, receptor related 2
    • NTRKR2
    • Receptor tyrosine kinase-like orphan receptor 2
    • receptor-related 2
    • ROR2
    • ROR2_HUMAN
    • Tyrosine protein kinase transmembrane receptor ROR2
    • Tyrosine-protein kinase transmembrane receptor Ror2
    see all
  • Function
    Tyrosine-protein kinase receptor which may be involved in the early formation of the chondrocytes. It seems to be required for cartilage and growth plate development. Phosphorylates YWHAB, leading to induction of osteogenesis and bone formation.
  • Involvement in disease
    Brachydactyly B1
    Robinow syndrome autosomal recessive
  • Sequence similarities
    Belongs to the protein kinase superfamily. Tyr protein kinase family. ROR subfamily.
    Contains 1 FZ (frizzled) domain.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 kringle domain.
    Contains 1 protein kinase domain.
  • Developmental stage
    Expressed at high levels during early embryonic development. The expression levels drop strongly around day 16 and there are only very low levels in adult tissues.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab159018 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159018 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159018.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up