Recombinant Human RPA32/RPA2 protein (ab101216)

Overview

  • Product name
    Recombinant Human RPA32/RPA2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMWNSGFESYGSSSYGGAGGYTQSPGGF GSPAPSQAEKKSRARAQHIVPCTISQLLSATLVDEVFRIGNVEISQVTIV GIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTSSENTVVPPETYVK VAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPS AGRAPISNPGMSEAGNFGGNSFMPANGLTVAQNQVLNLIKACPRPEGLNF QDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTDAE
    • Molecular weight
      32 kDa including tags
    • Amino acids
      1 to 270
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101216 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    ab101216 was purified using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: 0% None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 60S acidic ribosomal protein P1
    • AA409079
    • AI325195
    • AU020965
    • ik:tdsubc_2g1
    • M(2)21C
    • MGC137236
    • OTTHUMP00000004008
    • p32
    • p34
    • RCJMB04_6d17 replication protein A2, 32kDa
    • REPA2
    • Replication factor A protein 2
    • Replication protein A
    • Replication protein A 32 kDa subunit
    • Replication protein A 32kDa subunit
    • Replication protein A 34 kDa subunit
    • Replication protein A2
    • Replication Protein A2 (32kDa)
    • Replication protein A2, 32kDa
    • RF-A protein 2
    • Rf-A2
    • RFA
    • RFA2_HUMAN
    • RP-A p32
    • RP-A p34
    • RP21C
    • RPA
    • RPA 2
    • RPA 32
    • Rpa2
    • RPA32
    • RPA34
    • RpLP1
    • RpP2
    • xx:tdsubc_2g1
    • zgc:109822
    see all
  • Function
    Required for DNA recombination, repair and replication. The activity of RP-A is mediated by single-stranded DNA binding and protein interactions.
    Functions as component of the alternative replication protein A complex (aRPA). aRPA binds single-stranded DNA and probably plays a role in DNA repair; it does not support chromosomal DNA replication and cell cycle progression through S-phase. In vitro, aRPA cannot promote efficient priming by DNA polymerase alpha but supports DNA polymerase delta synthesis in the presence of PCNA and replication factor C (RFC), the dual incision/excision reaction of nucleotide excision repair and RAD51-dependent strand exchange.
  • Post-translational
    modifications
    Phosphorylated in a cell-cycle-dependent manner (from the S phase until mitosis). Phosphorylated by ATR upon DNA damage, which promotes its translocation to nuclear foci. Can be phosphorylated in vitro by PRKDC/DNA-PK in the presence of Ku and DNA, and by CDK1.
  • Cellular localization
    Nucleus. Nucleus > PML body. Also present in PML nuclear bodies. Redistributes to discrete nuclear foci upon DNA damage.
  • Information by UniProt

Images

  • ab101216 at 3 µg analysed by 15% SDS PAGE.

References

ab101216 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101216.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up