Recombinant Human RPA32/RPA2 protein (ab101216)

Overview

  • Product nameRecombinant Human RPA32/RPA2 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP15927
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSMWNSGFESYGSSSYGGAGGYTQSPGGF GSPAPSQAEKKSRARAQHIVPCTISQLLSATLVDEVFRIGNVEISQVTIV GIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTSSENTVVPPETYVK VAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPS AGRAPISNPGMSEAGNFGGNSFMPANGLTVAQNQVLNLIKACPRPEGLNF QDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTDAE
    • Molecular weight32 kDa including tags
    • Amino acids1 to 270
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101216 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 85 % SDS-PAGE.
    ab101216 was purified using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: 0% None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 60S acidic ribosomal protein P1
    • AA409079
    • AI325195
    • AU020965
    • ik:tdsubc_2g1
    • M(2)21C
    • MGC137236
    • OTTHUMP00000004008
    • p32
    • p34
    • RCJMB04_6d17 replication protein A2, 32kDa
    • REPA2
    • Replication factor A protein 2
    • Replication protein A
    • Replication protein A 32 kDa subunit
    • Replication protein A 32kDa subunit
    • Replication protein A 34 kDa subunit
    • Replication protein A2
    • Replication Protein A2 (32kDa)
    • Replication protein A2, 32kDa
    • RF-A protein 2
    • Rf-A2
    • RFA
    • RFA2_HUMAN
    • RP-A p32
    • RP-A p34
    • RP21C
    • RPA
    • RPA 2
    • RPA 32
    • Rpa2
    • RPA32
    • RPA34
    • RpLP1
    • RpP2
    • xx:tdsubc_2g1
    • zgc:109822
    see all
  • FunctionRequired for DNA recombination, repair and replication. The activity of RP-A is mediated by single-stranded DNA binding and protein interactions.
    Functions as component of the alternative replication protein A complex (aRPA). aRPA binds single-stranded DNA and probably plays a role in DNA repair; it does not support chromosomal DNA replication and cell cycle progression through S-phase. In vitro, aRPA cannot promote efficient priming by DNA polymerase alpha but supports DNA polymerase delta synthesis in the presence of PCNA and replication factor C (RFC), the dual incision/excision reaction of nucleotide excision repair and RAD51-dependent strand exchange.
  • Post-translational
    modifications
    Phosphorylated in a cell-cycle-dependent manner (from the S phase until mitosis). Phosphorylated by ATR upon DNA damage, which promotes its translocation to nuclear foci. Can be phosphorylated in vitro by PRKDC/DNA-PK in the presence of Ku and DNA, and by CDK1.
  • Cellular localizationNucleus. Nucleus > PML body. Also present in PML nuclear bodies. Redistributes to discrete nuclear foci upon DNA damage.
  • Information by UniProt

Recombinant Human RPA32/RPA2 protein images

  • ab101216 at 3 µg analysed by 15% SDS PAGE.

References for Recombinant Human RPA32/RPA2 protein (ab101216)

ab101216 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101216.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"