Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSKSGFGSYGSISAADGASGGSDQLCERDATPAIKTQRPKVRIQDVVPCN VNQLLSSTVFDPVFKVRGIIVSQVSIVGVIRGAEKASNHICYKIDDMTAK PIEARQWFGREKVKQVTPLSVGVYVKVFGILKCPTGTKSLEVLKIHVLED MNEFTVHILETVNAHMMLDKARRDTTVESVPVSPSEVNDAGDNDESHRNF IQDEVLRLIHECPHQEGKSIHELRAQLCDLSVKAIKEAIDYLTVEGHIYP TVDREHFKSAD
    • Amino acids
      1 to 261
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162273 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • HSU24186
    • MGC120333
    • MGC120334
    • p30
    • Replication factor A protein 4
    • Replication protein A 30 kDa subunit
    • RF A
    • RF-A protein 4
    • RFA
    • RFA4_HUMAN
    • RP A
    • RP-A p30
    • RPA
    • RPA4
    see all
  • Function
    Functions as component of the alternative replication protein A complex (aRPA). aRPA binds single-stranded DNA and probably plays a role in DNA repair; it does not support chromosomal DNA replication and cell cycle progression through S-phase. In vitro, aRPA cannot promote efficient priming by DNA polymerase alpha but supports DNA polymerase delta synthesis in the presence of PCNA and replication factor C (RFC), the dual incision/excision reaction of nucleotide excision repair and RAD51-dependent strand exchange.
  • Tissue specificity
    Preferentially expressed in placental and colon mucosa. Widely expressed at intermediate or lower levels.
  • Cellular localization
    Nucleus. Localizes to DNA repair foci after DNA damage.
  • Information by UniProt

Images

  • ab162273 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162273 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162273.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up