Overview

  • Product name
    Recombinant Human RPIP8 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEASFVQTTMALGLSSKKASSRNVAVERKNLITVCRFSVKTLLEKYTAEP IDDSSEEFVNFAAILEQILSHRFKACAPAGPVSWFSSDGQRGFWDYIRLA CSKVPNNCVSSIENMENISTARAKGRAWIRVALMEKRMSEYITTALRDTR TTRRFYDSGAIMLRDEATILTGMLIGLSAIDFSFCLKGEVLDGKTPVVID YTPYLKFTQSYDYLTDEEERYSAESSTSEDNSPEHPYLPLVTDEDSWYSK WHKMEQKFRIVYAQKGYLEELVRLRESQLKDLEAENRRLQLQLEEAAAQN QREKRELEGVILELQEQLTGLIPSDHAPLAQGSKELTTPLVNQWPSLGTL NGAEGASNSKLYRRHSFMSTEPLSAEASLSSDSQRLGEGTRDEEPWGPIG SSEPN
    • Amino acids
      1 to 405
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161193 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • RaP2 interacting protein 8
    • RAP2IP
    • RPIP 8
    • RPIP8 protein
    • RUN domain containing 3A
    • RUN domain containing protein 3A
    • RUNDC 3A
    • RUNDC3A
    see all
  • Relevance
    RPIP8 (RaP2 interacting protein 8) interacts with the GTP-bound form of RAP2A. It may act as an effector of RAP2A in neuronal cells. There are four named isoforms produced by alternative splicing.

Images

  • ab161193 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161193 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161193.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up