Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP30050
    • SpeciesHuman
    • SequenceMPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKAT GDWKGLRITVKLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKH SGNITFDEIVNIARQMRHRSLARELSGTIKEILGTAQSVGCNVDGRHPHD IIDDINSGAVECPAS
    • Molecular weight44 kDa including tags
    • Amino acids1 to 165

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116921 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • 60S ribosomal protein L12
    • L12
    • Ribosomal protein L12
    • RL12_HUMAN
    • rpl12
    see all
  • FunctionBinds directly to 26S ribosomal RNA.
  • Sequence similaritiesBelongs to the ribosomal protein L11P family.
  • Information by UniProt

Recombinant Human RPL12 protein images

  • 12.5% SDS-PAGE showing ab116921 at approx. 44.22 kDa. Stained with Coomassie Blue.

References for Recombinant Human RPL12 protein (ab116921)

ab116921 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116921.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"