Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP26373
    • SpeciesHuman
    • SequenceMAPSRNGMVLKPHFHKDWQRRVATWFNQPARKIRRRKARQAKARHIAPRP ASGPIRPIVRCPTVRYHTKVRAGRGFSLEELRVAGIHKKVARTIGISVDP RRRNKSTESLQANVQRLKEYRSKLILFPRKPSAPKKGDSSAEELKLATQL TGPVMPVRNVYKKEKARVITEEEKNFKAFASLRMARANARLFGIRAKRAK EAAEQDVEKKK
    • Molecular weight49 kDa including tags
    • Amino acids1 to 211

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114883 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 60S ribosomal protein L13
    • BBC1
    • Breast basic conserved gene 1
    • Breast basic conserved protein 1
    • D16S444E
    • D16S44E
    • FLJ27453
    • FLJ27454
    • L13
    • MGC117342
    • MGC71373
    • OK/SW cl.46
    • OK/SWcl.46
    • Ribosomal protein L13
    • RL13_HUMAN
    • rpl13
    see all
  • Tissue specificityHigher levels of expression in benign breast lesions than in carcinomas.
  • Sequence similaritiesBelongs to the ribosomal protein L13e family.
  • Information by UniProt

Recombinant Human RPL13 protein images

  • 12.5% SDS-PAGE showing ab114883 at approximately 49.32kDa.
    Stained with Coomassie Blue.

References for Recombinant Human RPL13 protein (ab114883)

ab114883 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114883.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"