Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVFRRFVEVGRVAYVSFGPHAGKLVAIVDVIDQNRALVDGPCTQVRRQAM PFKCMQLTDFILKFPHSAHQKYVRQAWQKADINTKWAATR
    • Amino acids
      1 to 90
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160307 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3100001N19Rik
    • 60S ribosomal protein L14
    • AA407502
    • AL022816
    • CAG ISL 7
    • CAG-ISL 7
    • CTG B33
    • hRL 14
    • hRL14
    • L14
    • MGC88594
    • Ribosomal protein L14
    • RL 14
    • RL14
    • RL14_HUMAN
    • RP L14
    • RPL 14
    • rpl14
    see all
  • Sequence similarities
    Belongs to the ribosomal protein L14e family.
  • Information by UniProt

Images

  • ab160307 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160307 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160307.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up