Overview

  • Product name
    Recombinant Human RPL17 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MVRYSLDPEDPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKATKYLKD VTLQKQCVPFRRYNGGVGRCAQAKQWGWTQGRWPKKSAEFLLHMLKNAES NAELKGLDVDSLVIEHIQVNKAPKVRRRTYRAHGRINPYMSSPCHIEMIL TEKEQIVPKPEEEVAQKKKISQKKLKKQKLMARE
    • Molecular weight
      46 kDa including tags
    • Amino acids
      1 to 185

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116783 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 60S ribosomal protein L17
    • 60S ribosomal protein L23
    • FLJ92089
    • Gene encoding putative NFkB activating protein
    • L17
    • MGC117162
    • PD 1
    • PD-1
    • PD1
    • Ribosomal protein L17
    • RL17_HUMAN
    • RPL17
    • rpL23
    see all
  • Tissue specificity
    Expressed in pancreas, lung, colon, cystic duct, gall bladder, kidney and liver. Expressed at high levels in the well differentiated pancreatic tumor cell lines HPAF, Colo 357 and Capan-1, the moderately differentiated pancreatic tumor cell lines T3M4, AsPc-1 and BxPc-3, the poorly differentiated pancreatic tumor cell line Mia Paca, and the pancreatic tumor cell lines of undefined differentiation status Panc 89 and SW 979. Expressed at lower levels in the poorly differentiated pancreatic tumor cell lines HGC 25 and Panc 1.
  • Sequence similarities
    Belongs to the ribosomal protein L22P family.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116783 at approximately 46.35kDa.
    Stained with Coomassie Blue.

References

ab116783 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116783.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up