Overview

  • Product nameRecombinant Human RPL17 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP18621
    • SpeciesHuman
    • SequenceMVRYSLDPEDPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKATKYLKD VTLQKQCVPFRRYNGGVGRCAQAKQWGWTQGRWPKKSAEFLLHMLKNAES NAELKGLDVDSLVIEHIQVNKAPKVRRRTYRAHGRINPYMSSPCHIEMIL TEKEQIVPKPEEEVAQKKKISQKKLKKQKLMARE
    • Molecular weight46 kDa including tags
    • Amino acids1 to 185

Specifications

Our Abpromise guarantee covers the use of ab116783 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 60S ribosomal protein L17
    • 60S ribosomal protein L23
    • FLJ92089
    • Gene encoding putative NFkB activating protein
    • L17
    • MGC117162
    • PD 1
    • PD-1
    • PD1
    • Ribosomal protein L17
    • RL17_HUMAN
    • RPL17
    • rpL23
    see all
  • Tissue specificityExpressed in pancreas, lung, colon, cystic duct, gall bladder, kidney and liver. Expressed at high levels in the well differentiated pancreatic tumor cell lines HPAF, Colo 357 and Capan-1, the moderately differentiated pancreatic tumor cell lines T3M4, AsPc-1 and BxPc-3, the poorly differentiated pancreatic tumor cell line Mia Paca, and the pancreatic tumor cell lines of undefined differentiation status Panc 89 and SW 979. Expressed at lower levels in the poorly differentiated pancreatic tumor cell lines HGC 25 and Panc 1.
  • Sequence similaritiesBelongs to the ribosomal protein L22P family.
  • Information by UniProt

Recombinant Human RPL17 protein images

  • 12.5% SDS-PAGE showing ab116783 at approximately 46.35kDa.
    Stained with Coomassie Blue.

References for Recombinant Human RPL17 protein (ab116783)

ab116783 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116783.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"