Recombinant Human RPL23A protein (ab116905)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP62750
    • SpeciesHuman
    • SequenceMAPKAKKEAPAPPKAEAKAKALKAKKAVLKGVHSHKKKKIRTSPTFRRPK TLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKIEDNNTLVFIV DVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA NKIGII
    • Molecular weight43 kDa including tags
    • Amino acids1 to 156

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116905 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 60S ribosomal protein L23A
    • FLJ27455
    • L23A
    • MDA20
    • Melanoma differentiation-associated gene 20
    • Ribosomal protein L23a
    • RL23A_HUMAN
    • RPL23A
    see all
  • FunctionThis protein binds to a specific region on the 26S rRNA.
  • Sequence similaritiesBelongs to the ribosomal protein L23P family.
  • Post-translational
    modifications
    N-terminus is methylated by METTL11A/NTM1.
  • Information by UniProt

Recombinant Human RPL23A protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116905 at approximately 43.23 kDa.

References for Recombinant Human RPL23A protein (ab116905)

ab116905 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116905.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"