Recombinant Human RPL7 protein (ab91722)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceTLKKKRRNFAELKIKRLRKKFAQKMLRKARRKLIYEKAKHYHKEYRQMYR TE IRMARMARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRL RQIFNG TFVKLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKI NKKRIALTDN ALIARSLGKYGIICMEDLIHEIYTVGKRFKEANNFLWP FKLSSPRGGMKKKT THFVEGGDAGNREDQINRLIRRMN (Amino acid sequence (Sequence determined by 5' Sequencing))
    • Amino acids17 to 248

Specifications

Our Abpromise guarantee covers the use of ab91722 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • FormLyophilised
  • Additional notesProtein Identity confirmed by Mass Spectrometry (MS/MS) (acquired on initial reference batch)
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5

  • ReconstitutionReconstitute with 65 µl aqua dest.

General Info

  • Alternative names
    • 60S ribosomal protein L7
    • humL7 1
    • L7
    • Ribosomal protein L7
    • RL7_HUMAN
    • RPL 7
    • RPL7
    • Rpl7a
    • Surf 3
    see all
  • FunctionBinds to G-rich structures in 28S rRNA and in mRNAs. Plays a regulatory role in the translation apparatus; inhibits cell-free translation of mRNAs.
  • Sequence similaritiesBelongs to the ribosomal protein L30P family.
  • Information by UniProt

Recombinant Human RPL7 protein images

  • The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

References for Recombinant Human RPL7 protein (ab91722)

ab91722 has not yet been referenced specifically in any publications.

Product Wall

The reconstitution volume ab91722 is lot-specific.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"