Overview

  • Product nameRecombinant Human RPP30 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP78346
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSMAVFADLDLRAGSDLKALRGLVETAAH LGYSVVAINHIVDFKEKKQEIEKPVAVSELFTTLPIVQGKSRPIKILTRL TIIVSDPSHCNVLRATSSRARLYDVVAVFPKTEKLFHIACTHLDVDLVCI TVTEKLPFYFKRPPINVAIDRGLAFELVYSPAIKDSTMRRYTISSALNLM QICKGKNVIISSAAERPLEIRGPYDVANLGLLFGLSESDAKAAVSTNCRA ALLHGETRKTAFGIISTVKKPRPSEGDEDCLPASKKAKCEG
    • Molecular weight32 kDa including tags
    • Amino acids1 to 268
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab102557 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab102557 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 5mM DTT, 200mM Sodium chloride, 20mM Tris HCl, 1mM EDTA, pH 8.0

General Info

  • Alternative names
    • FLJ38491
    • Ribonuclease P protein subunit p30
    • RNase P subunit 2
    • RNaseP protein p30
    • RNASEP2
    • RP11-320F15.1
    • RPP30
    • RPP30_HUMAN
    • TSG15
    see all
  • Information by UniProt

Recombinant Human RPP30 protein images

  • 15% SDS-PAGE analysis of ab102557 (3 µg).

References for Recombinant Human RPP30 protein (ab102557)

ab102557 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab102557.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"