Overview

  • Product name
    Recombinant Human RPP30 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMAVFADLDLRAGSDLKALRGLVETAAH LGYSVVAINHIVDFKEKKQEIEKPVAVSELFTTLPIVQGKSRPIKILTRL TIIVSDPSHCNVLRATSSRARLYDVVAVFPKTEKLFHIACTHLDVDLVCI TVTEKLPFYFKRPPINVAIDRGLAFELVYSPAIKDSTMRRYTISSALNLM QICKGKNVIISSAAERPLEIRGPYDVANLGLLFGLSESDAKAAVSTNCRA ALLHGETRKTAFGIISTVKKPRPSEGDEDCLPASKKAKCEG
    • Molecular weight
      32 kDa including tags
    • Amino acids
      1 to 268
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab102557 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab102557 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 5mM DTT, 200mM Sodium chloride, 20mM Tris HCl, 1mM EDTA, pH 8.0

General Info

  • Alternative names
    • FLJ38491
    • Ribonuclease P protein subunit p30
    • RNase P subunit 2
    • RNaseP protein p30
    • RNASEP2
    • RP11-320F15.1
    • RPP30
    • RPP30_HUMAN
    • TSG15
    see all
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab102557 (3 µg).

References

ab102557 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab102557.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up