Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP62841
    • SpeciesHuman
    • SequenceMAEVEQKKKRTFRKFTYRGVDLDQLLDMSYEQLMQLYSARQRRRLNRGLR RKQHSLLKRLRKAKKEAPPMEKPEVVKTHLRDMIILPEMVGSMVGVYNGK TFNQVEIKPEMIGHYLGEFSITYKPVKHGRPGIGATHSSRFIPLK
    • Molecular weight42 kDa including tags
    • Amino acids1 to 145

Specifications

Our Abpromise guarantee covers the use of ab116874 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 40S ribosomal protein S15
    • Homolog of rat insulinoma
    • Insulinoma protein
    • Ribosomal protein S15
    • RIG
    • RIG protein
    • RPS 15
    • rps15
    • RS15_HUMAN
    • S15
    see all
  • Sequence similaritiesBelongs to the ribosomal protein S19P family.
  • Information by UniProt

References for Recombinant Human RPS15 protein (ab116874)

ab116874 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116874.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"