Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      APYDENWFYTRAASTARHLYLRGGAGVGSMTKIYGGRQRNGVMPSHFSRG SKSVARRVLQALEGLKMVEKDQDGGRKLTPQGQRDLDRIAGQVAAANKKH
    • Molecular weight
      37 kDa including tags
    • Amino acids
      46 to 145

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114627 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 40S ribosomal protein S19
    • DBA
    • DBA1
    • HGNC:10402
    • Ribosomal protein S19
    • rps19
    • RS19_HUMAN
    • S19
    see all
  • Function
    Required for pre-rRNA processing and maturation of 40S ribosomal subunits.
  • Tissue specificity
    Higher level expression is seen in the colon carcinoma tissue than normal colon tissue.
  • Involvement in disease
    Defects in RPS19 are the cause of Diamond-Blackfan anemia type 1 (DBA1) [MIM:105650]. DBA1 is a form of Diamond-Blackfan anemia, a congenital non-regenerative hypoplastic anemia that usually presents early in infancy. Diamond-Blackfan anemia is characterized by a moderate to severe macrocytic anemia, erythroblastopenia, and an increased risk of malignancy. 30 to 40% of Diamond-Blackfan anemia patients present with short stature and congenital anomalies, the most frequent being craniofacial (Pierre-Robin syndrome and cleft palate), thumb and urogenital anomalies.
  • Sequence similarities
    Belongs to the ribosomal protein S19e family.
  • Cellular localization
    Nucleus. Located more specifically in the nucleoli.
  • Information by UniProt

Recombinant Human RPS19 protein images

  • ab114627 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References for Recombinant Human RPS19 protein (ab114627)

ab114627 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114627.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up