Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP15880
    • SpeciesHuman
    • SequenceMADDAGAAGGPGGPGGPGMGNRGGFRGGFGSGIRGRGRGRGRGRGRGRGA RGGKAEDKEWMPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGA SLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATA IRGAIILAKLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPAPR GTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSY LTPDLWKETVFTKSPYQEFTDHLVKTHTRVSVQRTQAPAVATT
    • Molecular weight58 kDa including tags
    • Amino acids1 to 293

Specifications

Our Abpromise guarantee covers the use of ab116767 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 40S ribosomal protein S2
    • 40S ribosomal protein S4
    • LLREP3
    • LLRep3 protein
    • MGC102851
    • MGC117344
    • MGC117345
    • OK/KNS-cl.6
    • Protein LLRep3
    • Ribosomal protein S2
    • rps2
    • RPS4
    • RS2
    • RS2_HUMAN
    • S2
    • S4
    see all
  • Sequence similaritiesBelongs to the ribosomal protein S5P family.
    Contains 1 S5 DRBM domain.
  • Information by UniProt

Recombinant Human RPS2 protein images

  • 12.5% SDS-PAGE showing ab116767 at approximately 58.34kDa; stained with Coomassie Blue.

References for Recombinant Human RPS2 protein (ab116767)

ab116767 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116767.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"