Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP62847
    • SpeciesHuman
    • SequenceMNDTVTIRTRKFMTNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKT TPDVIFVFGFRTHFGGGKTTGFGMIYDSLDYAKKNEPKHRLARHGLYEKK KTSRKQRKERKNRMKKVRGTAKANVGAGKK
    • Molecular weight40 kDa including tags
    • Amino acids1 to 130

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116836 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 40S ribosomal protein S24
    • DBA3
    • DKFZp686N1586
    • ribosomal protein S24
    • S24
    see all
  • RelevanceRibosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S24E family of ribosomal proteins. It is located in the cytoplasm. Multiple transcript variants encoding different isoforms have been found for this gene. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Mutations in this gene result in Diamond-Blackfan anemia.
  • Cellular localizationCytosolic small ribosomal subunit

Recombinant Human RPS24 protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116836 at approximately 40.37 kDa.

References for Recombinant Human RPS24 protein (ab116836)

ab116836 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116836.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"