Overview

  • Product nameRecombinant Human RPS3 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP23396
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAVQISKKRKFVADGIFKAELNEFLTRELA EDGYSGVEVRVTPTRTEIIILATRTQNVLGEKGRRIRELTAVVQKRFGFP EGSVELYAEKVATRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFIMESG AKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPVNYYVDTAVRHVLLRQG VLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDEILPTTPISEQKGGK PEPPAMPQPVPTA
    • Molecular weight29 kDa
    • Amino acids1 to 263
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113158 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab113158 was purified by using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% DTT, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • 40S ribosomal protein S3
    • fb13d09
    • FLJ26283
    • FLJ27450
    • IMR 90 ribosomal protein S3
    • MGC56088
    • MGC87870
    • OTTHUMP00000229804
    • OTTHUMP00000229805
    • OTTHUMP00000229874
    • OTTHUMP00000229877
    • OTTHUMP00000229878
    • OTTHUMP00000229879
    • OTTHUMP00000229880
    • OTTHUMP00000229882
    • OTTHUMP00000229883
    • OTTHUMP00000229886
    • Ribosomal protein S3
    • rps3
    • RS3_HUMAN
    • S3
    • wu:fb13d09
    • zgc:56088
    see all
  • Sequence similaritiesBelongs to the ribosomal protein S3P family.
    Contains 1 KH type-2 domain.
  • Cellular localizationCytoplasm. Localized in cytoplasmic mRNP granules containing untranslated mRNAs.
  • Information by UniProt

Recombinant Human RPS3 protein images

  • ab113158 at 3 µg analysed by 15% SDS PAGE. The molecular weight on SDS-PAGE will appear higher than predicted.

References for Recombinant Human RPS3 protein (ab113158)

ab113158 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113158.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"