Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      IRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIEKACQSIYPLHDVFVR KVKMLKKPKFELGKLMELHGEGSSSGKATGDETGAKVERADGYEPPVQES
    • Molecular weight
      37 kDa including tags
    • Amino acids
      164 to 263

Specifications

Our Abpromise guarantee covers the use of ab116805 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • 40S ribosomal protein S3a
    • Fte 1
    • Fte-1
    • FTE1
    • MFTL
    • ribosomal protein S3A
    • RPS3A
    • RS3A_HUMAN
    • S3A
    • v fos transformation effector protein
    • v fos transformation effector protein 1
    • V-fos transformation effector protein
    see all
  • Function
    May play a role during erythropoiesis through regulation of transcription factor DDIT3.
  • Sequence similarities
    Belongs to the ribosomal protein S3Ae family.
  • Cellular localization
    Cytoplasm. Nucleus. Localized in cytoplasmic mRNP granules containing untranslated mRNAs.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116805 at approximately kDa.
    Stained with Coomassie Blue.

References

ab116805 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116805.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up