Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP61247
    • SpeciesHuman
    • SequenceIRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIEKACQSIYPLHDVFVR KVKMLKKPKFELGKLMELHGEGSSSGKATGDETGAKVERADGYEPPVQES
    • Molecular weight37 kDa including tags
    • Amino acids164 to 263

Specifications

Our Abpromise guarantee covers the use of ab116805 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • 40S ribosomal protein S3a
    • Fte 1
    • Fte-1
    • FTE1
    • MFTL
    • ribosomal protein S3A
    • RPS3A
    • RS3A_HUMAN
    • S3A
    • v fos transformation effector protein
    • v fos transformation effector protein 1
    • V-fos transformation effector protein
    see all
  • FunctionMay play a role during erythropoiesis through regulation of transcription factor DDIT3.
  • Sequence similaritiesBelongs to the ribosomal protein S3Ae family.
  • Cellular localizationCytoplasm. Nucleus. Localized in cytoplasmic mRNP granules containing untranslated mRNAs.
  • Information by UniProt

Recombinant Human RPS3A protein images

  • 12.5% SDS-PAGE showing ab116805 at approximately kDa.
    Stained with Coomassie Blue.

References for Recombinant Human RPS3A protein (ab116805)

ab116805 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116805.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"