Overview

  • Product name
    Recombinant Human RPS7 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSHMFSSSAKIVKPNGEKPDEFESGISQA LLELEMNSDLKAQLRELNITAAKEIEVGGGRKAIIIFVPVPQLKSFQKIQ VRLVRELEKKFSGKHVVFIAQRRILPKPTRKSRTKNKQKRPRSRTLTAVH DAILEDLVFPSEIVGKRIRVKLDGSRLIKVHLDKAQQNNVEHKVETFSGV YKKLTGKDVNFEFPEFQL
    • Molecular weight
      25 kDa including tags
    • Amino acids
      1 to 194
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab117224 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab117224 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.58% Sodium chloride, 30% Glycerol, 0.02% DTT

General Info

  • Alternative names
    • 40S ribosomal protein S7
    • DBA8
    • Ribosomal protein S7
    • RPS 7
    • rps7
    • RS7_HUMAN
    • S7
    see all
  • Function
    Required for rRNA maturation.
  • Involvement in disease
    Defects in RPS7 are the cause of Diamond-Blackfan anemia type 8 (DBA8) [MIM:612563]. DBA8 is a form of Diamond-Blackfan anemia, a congenital non-regenerative hypoplastic anemia that usually presents early in infancy. Diamond-Blackfan anemia is characterized by a moderate to severe macrocytic anemia, erythroblastopenia, and an increased risk of malignancy. 30 to 40% of Diamond-Blackfan anemia patients present with short stature and congenital anomalies, the most frequent being craniofacial (Pierre-Robin syndrome and cleft palate), thumb and urogenital anomalies.
  • Sequence similarities
    Belongs to the ribosomal protein S7e family.
  • Information by UniProt

Recombinant Human RPS7 protein images

  • 15% SDS-PAGE showing ab117224 at approximately 24.7kDa (3µg).

References for Recombinant Human RPS7 protein (ab117224)

ab117224 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117224.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up