Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      FLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQ KHIDFSLRSPYGGGRPGRVKRKNAKKGQGGAGAGDDEEED
    • Amino acids
      105 to 194
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159436 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 40S ribosomal protein S9
    • OTTHUMP00000069577
    • OTTHUMP00000069584
    • OTTHUMP00000069585
    • OTTHUMP00000194980
    • OTTHUMP00000197717
    • OTTHUMP00000197718
    • OTTHUMP00000197719
    • OTTHUMP00000206570
    • Ribosomal protein S9
    • rps9
    • RS9_HUMAN
    • S9
    see all
  • Sequence similarities
    Belongs to the ribosomal protein S4P family.
    Contains 1 S4 RNA-binding domain.
  • Cellular localization
    Cytoplasm. Localized in cytoplasmic mRNP granules containing untranslated mRNAs.
  • Information by UniProt

Images

  • ab159436 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159436 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159436.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up