Overview

  • Product name
    Recombinant Human RQCD1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMHSLATAAPVPTTLAQVDREKIYQWINELS SPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEI VNIYPSINPPTLTAHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLY PFLHTVSKTRPFEYLRLTSLGVIGALVKTDEQEVINFLLTTEIIPLCLRI MESGSELSKTVATFILQKILLDDTGLAYICQTYERFSHVAMILGKMVLQL SKEPSARLLKHVVRCYLRLSDNPRAREALRQCLPDQLKDTTFAQVLKDDT TTKRWLAQLVKNLQEGQVTDPRGIPLPPQ
    • Molecular weight
      36 kDa including tags
    • Amino acids
      1 to 299
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101208 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab101208 was purified using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • CAF40
    • CCR4-NOT transcription complex subunit 9
    • Cell differentiation protein RCD1 homolog
    • CNOT9
    • CT129
    • Homo sapiens protein involved in sexual development complete cds
    • Rcd 1
    • Rcd-1
    • RCD1
    • Rcd1 (required for cell differentiation, S.pombe) homolog 1
    • RCD1 required for cell differentiation1 homolog
    • RCD1 required for cell differentiation1 homolog (S. pombe)
    • RCD1+
    • RCD1_HUMAN
    • rqcd1
    see all
  • Function
    Transcription factor that down-regulates MYB- and JUN-dependent transcription. May play a role in cell differentiation (By similarity). Can bind oligonucleotides, such as poly-G, poly-C or poly-T (in vitro), but the physiological relevance of this is not certain. Does not bind poly-A.
  • Tissue specificity
    Detected in spleen, thymus, prostate, testis, ovary and intestine.
  • Sequence similarities
    Belongs to the RCD1 family.
  • Cellular localization
    Nucleus. Cytoplasm > P-body. NANOS2 promotes its localization to P-body.
  • Information by UniProt

Images

  • ab101208 at 3 µg analysed by 15% SDS PAGE.

References

ab101208 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101208.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up