Overview

  • Product nameRecombinant Human RQCD1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ92600
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMHSLATAAPVPTTLAQVDREKIYQWINELS SPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEI VNIYPSINPPTLTAHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLY PFLHTVSKTRPFEYLRLTSLGVIGALVKTDEQEVINFLLTTEIIPLCLRI MESGSELSKTVATFILQKILLDDTGLAYICQTYERFSHVAMILGKMVLQL SKEPSARLLKHVVRCYLRLSDNPRAREALRQCLPDQLKDTTFAQVLKDDT TTKRWLAQLVKNLQEGQVTDPRGIPLPPQ
    • Molecular weight36 kDa including tags
    • Amino acids1 to 299
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101208 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab101208 was purified using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • CAF40
    • CCR4-NOT transcription complex subunit 9
    • Cell differentiation protein RCD1 homolog
    • CNOT9
    • CT129
    • Homo sapiens protein involved in sexual development complete cds
    • Rcd 1
    • Rcd-1
    • RCD1
    • Rcd1 (required for cell differentiation, S.pombe) homolog 1
    • RCD1 required for cell differentiation1 homolog
    • RCD1 required for cell differentiation1 homolog (S. pombe)
    • RCD1+
    • RCD1_HUMAN
    • rqcd1
    see all
  • FunctionTranscription factor that down-regulates MYB- and JUN-dependent transcription. May play a role in cell differentiation (By similarity). Can bind oligonucleotides, such as poly-G, poly-C or poly-T (in vitro), but the physiological relevance of this is not certain. Does not bind poly-A.
  • Tissue specificityDetected in spleen, thymus, prostate, testis, ovary and intestine.
  • Sequence similaritiesBelongs to the RCD1 family.
  • Cellular localizationNucleus. Cytoplasm > P-body. NANOS2 promotes its localization to P-body.
  • Information by UniProt

Recombinant Human RQCD1 protein images

  • ab101208 at 3 µg analysed by 15% SDS PAGE.

References for Recombinant Human RQCD1 protein (ab101208)

ab101208 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101208.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"