Overview

  • Product nameRecombinant Human RRAD protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP55042
    • SpeciesHuman
    • SequenceVYKVLLLGAPGVGKSALARIFGGVEDGPEAEAAGHTYDRSIVVDGEEASL MVYDIWEQDGGRWLPGHCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRA RQTDDVPIIL
    • Molecular weight38 kDa including tags
    • Amino acids91 to 200

Specifications

Our Abpromise guarantee covers the use of ab114746 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GTP binding protein RAD
    • GTP-binding protein RAD
    • RAD
    • RAD_HUMAN
    • RAD1
    • RAS (RAD and GEM) like GTP binding 3
    • Ras associated with diabetes
    • Ras related associated with diabetes
    • REM3
    • RRAD
    see all
  • FunctionMay play an important role in cardiac antiarrhythmia via the strong suppression of voltage-gated L-type Ca(2+) currents. Regulates voltage-dependent L-type calcium channel subunit alpha-1C trafficking to the cell membrane (By similarity). Inhibits cardiac hypertrophy through the calmodulin-dependent kinase II (CaMKII) pathway. Inhibits phosphorylation and activation of CAMK2D.
  • Tissue specificityMost abundantly expressed in the heart. Also found in the skeletal muscle and lung. Lesser amounts in placenta and kidney. Also detected in adipose tissue. Overexpressed in muscle of type II diabetic humans.
  • Sequence similaritiesBelongs to the small GTPase superfamily. RGK family.
  • Cellular localizationCell membrane.
  • Information by UniProt

Recombinant Human RRAD protein images

  • 12.5% SDS-PAGE showing ab114746 at approximately 37.73kDa.
    Stained with Coomassie Blue.

References for Recombinant Human RRAD protein (ab114746)

ab114746 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114746.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"