Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSSGAASGTGRGRPRGGGPGPGDPPPSETHKLVVVGGGGVGKSALTIQFI QSYFVSDYDPTIEDSYTKICSVDGIPARLDILDTAGQEEFGAMREQYMRA GHGFLLVFAINDRQSFNEVGKLFTQILRVKDRDDFPVVLVGNKADLESQR QVPRSEASAFGASHHVAYFEASAKLRLNVDEAFEQLVRAVRKYQEQELPP SPPSAPRKKGGGCPCVLL
    • Molecular weight
      51 kDa including tags
    • Amino acids
      1 to 218

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114612 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    ab114612 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Oncogene RRAS
    • p23
    • R Ras
    • Ras related Protein
    • Ras related protein R Ras
    • Ras-related protein R-Ras
    • related RAS viral (r ras) oncogene homolog
    • RRAS
    • RRAS_HUMAN
    see all
  • Function
    Regulates the organization of the actin cytoskeleton.
  • Sequence similarities
    Belongs to the small GTPase superfamily. Ras family.
  • Cellular localization
    Cell membrane. Inner surface of plasma membrane possibly with attachment requiring acylation of the C-terminal cysteine.
  • Information by UniProt

Recombinant Human RRAS protein images

  • ab114612 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References for Recombinant Human RRAS protein (ab114612)

ab114612 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114612.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up