Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP23921
    • SpeciesHuman
    • SequenceDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLK MAAERGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTRP AANPIQFTLN
    • Molecular weight38 kDa including tags
    • Amino acids644 to 753

Specifications

Our Abpromise guarantee covers the use of ab114382 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    ab114382 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • R1
    • Ribonucleoside diphosphate reductase large subunit
    • Ribonucleoside diphosphate reductase M1 chain
    • Ribonucleoside diphosphate reductase subunit M1
    • Ribonucleoside reductase, large subunit
    • Ribonucleoside-diphosphate reductase large subunit
    • Ribonucleoside-diphosphate reductase subunit M1
    • Ribonucleotide reductase large chain
    • Ribonucleotide reductase large subunit
    • Ribonucleotide reductase M1
    • Ribonucleotide reductase M1 polypeptide
    • Ribonucleotide reductase R1 subunit
    • Ribonucleotide reductase, M1 subunit
    • RIR 1
    • RIR1
    • RIR1_HUMAN
    • RR 1
    • RR1
    • RRM 1
    • RRM1
    see all
  • FunctionProvides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides.
  • PathwayGenetic information processing; DNA replication.
  • Sequence similaritiesBelongs to the ribonucleoside diphosphate reductase large chain family.
    Contains 1 ATP-cone domain.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human RRM1 protein images

  • ab114382 analysed on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human RRM1 protein (ab114382)

ab114382 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114382.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"