Overview

  • Product name
    Recombinant Human RRP4 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ALKTRYIGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGEL RRRSAEDELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRS
    • Amino acids
      71 to 160
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161632 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EXOSC2
    • Exosome complex exonuclease RRP4
    • Exosome component 2
    • Homolog of yeast RRP4 (ribosomal RNA processing 4), 3' 5' exoribonuclease (RRP4)
    • Homolog of yeast RRP4 (ribosomal RNA processing 4), 3'-5'-exoribonuclease
    • hRrp4p
    • OTTHUMP00000022370
    • OTTHUMP00000022371
    • OTTHUMP00000022372
    • OTTHUMP00000022373
    • OTTHUMP00000022374
    • p7
    • Ribosomal RNA processing protein 4
    • RRP4
    • Rrp4p
    see all
  • Relevance
    The exosome, present in both the nucleus and cytoplasm of all eukaryotic cells, is a complex of 3'-5' exoribonucleases containing at least nine core components. Recently, it has been demonstrated, mainly by analyses in yeast, that the nuclear exosome is essential for rRNA processing and sn(o)RNA biogenesis. Furthermore, it is involved in the degradation of improperly processed mRNAs. The cytoplasmic exosome participates in normal mRNA turnover and in the degradation of inherently instable mRNAs that contain AU-rich elements. Therefore, the exosome plays a key role in RNA metabolism.
  • Cellular localization
    Cytoplasmic, Exosome and Nuclear

Images

  • ab161632 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161632 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161632.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up