Overview

  • Product name
    Recombinant Human RSBN1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAAQVGAVRVVRAVAAQEEPDKEGKEKPHAGVSPRGVKRQRRSSSGGSQE KRGRPSQEPPLAPPHRRRRSRQHPGPLPPTNAAPTVPGPVEPLLLPPPPP PSLAPAGPAVAAPLPAPSTSALFTFSPLTVSAAGPKHKGHKERHKHHHHR GPDGDPSSCGTDLKHKDKQENGERTGGVPLIKAPKRETPDENGKTQRADD FVLKKIKKKKKKKHREDMRGRRLKMYNKEVQTVCAGLTRISKEILTQGQI NSTSGLNKESFRYLKDEQLCRLNLGMQEYRVPQGVQTPFMTHQEHSIRRN FLKTGTKFSNFIHEEHQSNGGALVLHAYMDELSFLSPMEMERFSEEFLAL TFSENEKNAAYYALAIVHGAAAYLPDFLDYFAFNFPNTPVKMEILGKKDI ETTTISNFHTQ
    • Amino acids
      1 to 411
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162810 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C230004D03Rik
    • DKFZp781E21150
    • E330004N01
    • mKIAA3002
    • OTTHUMP00000013723
    • OTTMUSP00000028850
    • OTTMUSP00000028851
    • RGD1307231
    • ROSBIN
    • Rosbin, round spermatid basic protein 1
    • Round spermatid basic protein 1
    • RP11 324J2.1
    • Rsbn
    • Rsbp
    see all
  • Relevance
    RSBN1 belongs to the round spermatid basic protein 1 family. The function of this protein remains unknown.
  • Cellular localization
    Nuclear

Images

  • ab162810 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162810 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162810.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up