Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKETDREAVATAVQRVAGMLQRPDQLDKVEQYRRREARKKASVEARLKAA IQSQLDGVRTGLSQLHNALNDVKDIQQSLADVSKDWRQSINTIESLKDVK DAVVQHSQLAAAVENLKNIFSVPEIVRETQDLIEQGALLQAHRKLMDLEC SRDGLMYEQYRMDSGNTRDMTLIHGYFGSTQGLSDELAKQLWMVLQRSLV TVRRDPTLLVSVVRIIEREEKIDRRILDRKKQTGFVPPGRPKNWKEKMFT ILERTVTTRIEGTQADTRESDKMWLVRHLEIIRKYVLDDLIVAKNLMVQC FPPHYEIFKNLLNMYHQALSTRMQDLASEDLEANEIVSLLTWVLNTYTST EMMRNVELAPEVDVGTLEPLLSPHVVSELLDTYMSTLTSNIIAWLRKALE TDKKDWVKETEPEADQDGYYQTTLPAIVFQMFEQNLQVAAQISEDLKTKV LVLCLQQMNSFLSRYKDEAQLYKEEHLRNRQHPHCYVQYMIAIINNCQTF KESIVSLKRKYLKNEVEEGVSPSQPSMDGILDAIAKEGCSGLLEEVFLDL EQHLNELMTKKWLLGSNAVDIICVTVEDYFNDFAKIKKPYKKRMTAEAHR RVVVEYLRAVMQKRISFRSPEERKEGAEKMVREAEQLRFLFRKLASGFGE DVDGYCDTIVAVAEVIKLTDPSLLYLEVSTLVSKYPDIRDDHIGALLAVR GDASRDMKQTIMETLEQGPAQASPSYVPLFKDIVVPSLNVAKLLK
    • Amino acids
      1 to 745
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153182 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EXOC 3
    • Exoc3
    • EXOC3_HUMAN
    • Exocyst complex component 3
    • Exocyst complex component Sec 6
    • Exocyst complex component Sec6
    • rSec 6
    • Sec 6
    • Sec 6 homolog
    • Sec 6p
    • Sec6
    • SEC6 L1
    • SEC6 like 1
    • Sec6 protein
    • SEC6L1
    • Sec6p
    see all
  • Function
    Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane.
  • Sequence similarities
    Belongs to the SEC6 family.
  • Information by UniProt

Images

  • ab153182 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153182 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153182.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up