Recombinant Human Rsk 2 / MAPKAP Kinase 1b protein (ab159429)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ARIGSGKFSLSGGYWNSVSDTAKDLVSKMLHVDPHQRLTAALVLRHPWIV HWDQLPQYQLNRQDAPHLVKGAMAATYSALNRNQSPVLEPVGRSTLAQRR GIKKITSTAL
    • Amino acids
      631 to 740
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159429 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 90 kDa ribosomal protein S6 kinase 3
    • CLS
    • HU 3
    • HU2
    • HU3
    • Insulin stimulated protein kinase 1
    • Insulin-stimulated protein kinase 1
    • ISPK-1
    • ISPK1
    • KS6A3_HUMAN
    • MAP kinase activated protein kinase 1b
    • MAP kinase-activated protein kinase 1b
    • MAPK activated protein kinase 1b
    • MAPK-activated protein kinase 1b
    • MAPKAP kinase 1b
    • MAPKAPK 1b
    • MAPKAPK-1b
    • MAPKAPK1B
    • Mental retardation, X linked 19
    • MRX19
    • OTTHUMP00000023036
    • p90 RSK2
    • p90 RSK3
    • p90-RSK 3
    • p90RSK3
    • pp90RSK2
    • Ribosomal protein S6 kinase 90kDa polypeptide 3
    • Ribosomal protein S6 kinase alpha 3
    • Ribosomal protein S6 kinase alpha-3
    • Ribosomal protein s6 kinase ii alpha 2
    • Ribosomal S6 kinase 2
    • Rps6ka3
    • RSK
    • RSK-2
    • RSK2
    • S6 kinase 2
    • S6K alpha3
    • S6K-alpha-3
    see all
  • Function
    Serine/threonine kinase that may play a role in mediating the growth-factor and stress induced activation of the transcription factor CREB.
  • Tissue specificity
    Expressed in many tissues, highest levels in skeletal muscle.
  • Involvement in disease
    Defects in RPS6KA3 are the cause of Coffin-Lowry syndrome (CLS) [MIM:303600]; an X-linked dominant disorder characterized by severe mental retardation with facial and digital dysmorphisms, and progressive skeletal deformations.
  • Sequence similarities
    Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. S6 kinase subfamily.
    Contains 1 AGC-kinase C-terminal domain.
    Contains 2 protein kinase domains.
  • Post-translational
    modifications
    Autophosphorylated on Ser-386, as part of the activation process.
    Ser-227 phosphorylation promotes Ser-386 phosphorylation and leads to basal activation. Full activation by growth factors requires additional phosphorylation on Ser-369.
  • Information by UniProt

Images

  • ab159429 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159429 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159429.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up