Recombinant human RSPO3 protein (BSA and azide free) (ab174048)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMK QIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLH LGKCLDNCPEGLEANNHTMECVSIV
    • Molecular weight
      15 kDa including tags
    • Amino acids
      22 to 146
    • Tags
      His tag C-Terminus
    • Additional sequence information
      (AAH22367)

Specifications

Our Abpromise guarantee covers the use of ab174048 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured by its ability to induce activation of beta-catenin response in a Luciferase assay using HEK293T cells. The ED50 for this effect is typically 0.5 - 2.0 ng/ml in the presence of 5 ng/ml recombinant Wnt3a.

  • Applications

    SDS-PAGE

    Functional Studies

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • CRISTIN1
    • hPWTSR
    • hRspo3
    • Protein with TSP type-1 repeat
    • PWTSR
    • R-spondin 3 homolog
    • R-spondin-3
    • R-spondin-3 [Precursor]
    • Roof plate specific spondin-3
    • Roof plate-specific spondin-3
    • RSPO3
    • RSPO3_HUMAN
    • Thrombospondin type I domain containing 2
    • Thrombospondin type-1 domain-containing protein 2
    • THSD2
    see all
  • Function
    Activator of the beta-catenin signaling cascade, leading to TCF-dependent gene activation. Acts both in the canonical Wnt/beta-catenin-dependent pathway, possibly via a direct interaction with Wnt proteins, and in a Wnt-independent beta catenin pathway through a receptor signaling pathway that may not use frizzled/LRP receptors. Acts as a ligand for frizzled FZD8 and LRP6. May negatively regulate the TGF-beta pathway.
  • Tissue specificity
    Ubiquitously expressed. Expressed at higher level in placenta, small intestine, fetal thymus and lymph node.
  • Sequence similarities
    Belongs to the R-spondin family.
    Contains 2 FU (furin-like) repeats.
    Contains 1 TSP type-1 domain.
  • Domain
    The FU repeats are required for activation and stabilization of beta-catenin.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • SDS-PAGE analysis of RSPO3 in reducing conditions. Gel stained overnight with Coomassie Blue. Protein migrates as 18 kDa and 24 kDa due to different glycosylation.

References

ab174048 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174048.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up