Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      ELTQLKELHIQGNRLTVLPPELGNLDLTGQKQVFKAENNPWVTPIADQFQ LGVSHVFEYIRSETYKYLYGRHMQANPEPPKKNNDKSKKISRKPLAAKNR
    • Molecular weight
      37 kDa including tags
    • Amino acids
      178 to 277

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116729 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • FLJ31034
    • Ras suppressor protein 1
    • Ras suppressor protein 1 isoform 1
    • RSP 1
    • RSP-1
    • RSP1
    • RSU 1
    • Rsu-1
    • RSU1
    • RSU1 protein
    • RSU1_HUMAN
    see all
  • Function
    Potentially plays a role in the Ras signal transduction pathway. Capable of suppressing v-Ras transformation in vitro.
  • Sequence similarities
    Contains 7 LRR (leucine-rich) repeats.
  • Information by UniProt

Recombinant Human RSU1 protein images

  • 12.5% SDS-PAGE of ab116729 at approximately 36.63kDa stained with Coomassie Blue.

References for Recombinant Human RSU1 protein (ab116729)

ab116729 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116729.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up