Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      ELTQLKELHIQGNRLTVLPPELGNLDLTGQKQVFKAENNPWVTPIADQFQ LGVSHVFEYIRSETYKYLYGRHMQANPEPPKKNNDKSKKISRKPLAAKNR
    • Molecular weight
      37 kDa including tags
    • Amino acids
      178 to 277

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116729 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • FLJ31034
    • Ras suppressor protein 1
    • Ras suppressor protein 1 isoform 1
    • RSP 1
    • RSP-1
    • RSP1
    • RSU 1
    • Rsu-1
    • RSU1
    • RSU1 protein
    • RSU1_HUMAN
    see all
  • Function
    Potentially plays a role in the Ras signal transduction pathway. Capable of suppressing v-Ras transformation in vitro.
  • Sequence similarities
    Contains 7 LRR (leucine-rich) repeats.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE of ab116729 at approximately 36.63kDa stained with Coomassie Blue.

References

ab116729 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116729.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up