Overview

  • Product name
    Recombinant Human RTF1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKKQANKTASSGSSDKDSSAESSAPEEGEVSDSDSNSSSSSSDSDSSSED EEFHDGYGEDLMGDEEDRARLEQMTEKEREQELFNRIEKREVLKRRFEIK KKLKTAKKKEKKEKKKKQEEEQEKKKLTQIQESQVTSHNKERRSKRDEKL DKKSQAMEELKAEREKRKNRTAELLAKKQPLKTSEVYSDDEEEEEDDKSS EKSDRSSRTSSSDEEEEKEEIPPKSQPVSLPEELNRVRLSRHKLERWCHM PFFAKTVTGCFVRIGIGNHNSKPVYRVAEITGVVETAKVYQLGGTRTNKG LQLRHGNDQRVFRLEFVSNQEFTESEFMKWKEAMFSAGMQLPTLDEINKK ELSIKEALNYKFNDQDIEEIVKEKERFRKAPPNYAMKKTQLLKEKAMAED LGDQDKAKQIQDQLNELEERAEALDRQRTKNISAISYINQRNREWNIVES EKALVAESHNMKNQQMDPFTRRQCKPTIVSNSRDPAVQAAILAQLNAKYG SGVLPDAPKEMSKGQGKDKDLNSKSASDLSEDLFKVHDFDVKIDLQVPSS ESKALAITSKAPPAKDGAPRRSLNLEDYKKRRGLI
    • Amino acids
      1 to 585
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161557 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CDG1N
    • GTL 7
    • GTL7
    • KIAA0252
    • Ortholog of mouse gene trap locus 7
    • RNA polymerase associated protein RTF1 homolog
    • RNA polymerase-associated protein RTF1 homolog
    • RTF 1
    • RTF1
    • Rtf1 Paf1/RNA polymerase II complex component homolog
    • RTF1_HUMAN
    • rtf1L
    • YGL244W
    see all
  • Function
    Plays a role in transcription-coupled histone modification. Plays a role in regulation of transcription. Required for maximal induction of heat-shock genes (By similarity). Binds single-stranded DNA.
  • Sequence similarities
    Contains 1 Plus3 domain.
  • Domain
    The Plus3 domain mediates single-stranded DNA-binding.
  • Cellular localization
    Nucleus > nucleoplasm.
  • Information by UniProt

Images

  • ab161557 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161557 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161557.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up