Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SYLILALLSVTISFRIYKSVIQAVQKSEEGHPFKAYLDVDITLSSEAFHN YMNAAMVHINRALKLIIRLFLVEDLVDSLKLAVFMW
    • Amino acids
      84 to 169
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153067 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ASYIP
    • Neuroendocrine specific protein like 2
    • Neuroendocrine-specific protein-like 2
    • Neuroendocrine-specific protein-like II
    • NSP like protein II
    • NSP-like protein 2
    • NSP-like protein II
    • NSPL2
    • NSPLII
    • Reticulon 3
    • Reticulon-3
    • Reticulon3
    • Rtn3
    • RTN3_HUMAN
    see all
  • Function
    May be involved in membrane trafficking in the early secretory pathway. Inhibits BACE1 activity and amyloid precursor protein processing. May induce caspase-8 cascade and apoptosis. May favor BCL2 translocation to the mitochondria upon endoplasmic reticulum stress. In case of enteroviruses infection, RTN3 may be involved in the viral replication or pathogenesis.
  • Tissue specificity
    Isoform 3 is widely expressed, with highest levels in brain, where it is enriched in neuronal cell bodies from gray matter (at protein level). Three times more abundant in macula than in peripheral retina. Isoform 1 is expressed at high levels in brain and at low levels in skeletal muscle. Isoform 2 is only found in melanoma.
  • Sequence similarities
    Contains 1 reticulon domain.
  • Cellular localization
    Endoplasmic reticulum membrane. Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab153067 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153067 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153067.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up