Recombinant Human RTN4IP1 protein (ab116191)

Overview

  • Product name
    Recombinant Human RTN4IP1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHH SSGLVP RGSHMGS TVMPAWVIDKYGKNEVLRFTQNMMMPIIHYPNEVIVKVHAASVNPIDVNM RSGYGATALNMKRDPLHVKIKGEEFPLTLGRDVSGVVMECGLDVKYFKPG DEVWAAVPPWKQGTLSEFVVVSGNEVSHKPKSLTHTQAASLPYVALTAWS AINKVGGLNDKNCTGKRVLILGASGGVGTFAIQVMKAWDAHVTAVCSQDA SELVRKLGADDVIDYKSGSVEEQLKSLKPFDFILDNVGGSTETWAPDFLK KWSGATYVTLVTPFLLNMDRLGIADGMLQTGVTVGSKALKHFWKGVHYRW AFFMASGPCLDDIAELVDAGKIRPVIEQTFPFSKVPEAFLKVERGHARGK TVINVV
    • Molecular weight
      41 kDa including tags
    • Amino acids
      41 to 396
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116191 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab116191 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.02% DTT

General Info

  • Alternative names
    • MGC12934
    • mitochondrial
    • NIMP
    • NOGO interacting mitochondrial protein
    • NOGO-interacting mitochondrial protein
    • Reticulon 4 interacting protein 1
    • Reticulon 4 interacting protein 1, mitochondrial
    • Reticulon-4-interacting protein 1
    • RT4I1_HUMAN
    • Rtn4ip1
    see all
  • Function
    Appears to be a potent inhibitor of regeneration following spinal cord injury.
  • Tissue specificity
    Widely expressed in mitochondria-enriched tissues. Found in heart, muscle, kidney, liver, brain and placenta.
  • Sequence similarities
    Belongs to the zinc-containing alcohol dehydrogenase family. Quinone oxidoreductase subfamily.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Recombinant Human RTN4IP1 protein images

  • 15% SDS-PAGE analysis of 3 µg ab116191.

References for Recombinant Human RTN4IP1 protein (ab116191)

ab116191 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116191.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up