Recombinant Human RTN4IP1 protein (ab116191)

Overview

  • Product name
    Recombinant Human RTN4IP1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHH SSGLVP RGSHMGS TVMPAWVIDKYGKNEVLRFTQNMMMPIIHYPNEVIVKVHAASVNPIDVNM RSGYGATALNMKRDPLHVKIKGEEFPLTLGRDVSGVVMECGLDVKYFKPG DEVWAAVPPWKQGTLSEFVVVSGNEVSHKPKSLTHTQAASLPYVALTAWS AINKVGGLNDKNCTGKRVLILGASGGVGTFAIQVMKAWDAHVTAVCSQDA SELVRKLGADDVIDYKSGSVEEQLKSLKPFDFILDNVGGSTETWAPDFLK KWSGATYVTLVTPFLLNMDRLGIADGMLQTGVTVGSKALKHFWKGVHYRW AFFMASGPCLDDIAELVDAGKIRPVIEQTFPFSKVPEAFLKVERGHARGK TVINVV
    • Molecular weight
      41 kDa including tags
    • Amino acids
      41 to 396
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116191 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab116191 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.02% DTT

General Info

  • Alternative names
    • MGC12934
    • mitochondrial
    • NIMP
    • NOGO interacting mitochondrial protein
    • NOGO-interacting mitochondrial protein
    • Reticulon 4 interacting protein 1
    • Reticulon 4 interacting protein 1, mitochondrial
    • Reticulon-4-interacting protein 1
    • RT4I1_HUMAN
    • Rtn4ip1
    see all
  • Function
    Appears to be a potent inhibitor of regeneration following spinal cord injury.
  • Tissue specificity
    Widely expressed in mitochondria-enriched tissues. Found in heart, muscle, kidney, liver, brain and placenta.
  • Sequence similarities
    Belongs to the zinc-containing alcohol dehydrogenase family. Quinone oxidoreductase subfamily.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab116191.

References

ab116191 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116191.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up