Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ITSFEGKTNQVMSSMKQMEERLQHSERARQGAEERSHKLQQELGGRIGAL QLQLSQLHEQCSSLEKELKSEKEQRQALQRELQHEKDTSSLLRMELQQV
    • Amino acids
      376 to 474
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164231 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3000002E04Rik
    • FLJ22251
    • FYVE finger protein EIP1
    • FYVE-finger protein EIP1
    • La binding protein 1
    • La-binding protein 1
    • OTTHUMP00000161521
    • Rab4 interacting protein
    • Rab4-interacting protein
    • RABIP4
    • RUFY1
    • RUFY1_HUMAN
    • RUN and FYVE domain containing 1
    • RUN and FYVE domain-containing protein 1
    • RUN and FYVE domains containing protein 1
    • ZFYVE12
    • Zinc finger FYVE domain containing protein 12
    • Zinc finger FYVE domain-containing protein 12
    see all
  • Function
    Binds phospholipid vesicles containing phosphatidylinositol 3-phosphate and participates in early endosomal trafficking.
  • Tissue specificity
    Broadly expressed, with highest levels in lung, testis, kidney and brain.
  • Sequence similarities
    Contains 1 FYVE-type zinc finger.
    Contains 1 RUN domain.
  • Domain
    The FYVE-type zinc finger domain mediates interactions with phosphatidylinositol 3-phosphate in membranes of early endosomes and penetrates bilayers. The FYVE domain insertion into PtdIns(3)P-enriched membranes is substantially increased in acidic conditions.
  • Post-translational
    modifications
    Phosphorylation on Tyr-389 and/or Tyr-400 is required for interaction with BMX and endosomal targeting.
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Cytoplasm. Early endosome membrane.
  • Information by UniProt

Images

  • ab164231 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164231 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164231.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up