Recombinant Human RUNX1 / AML1 protein (ab112260)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ01196
    • SpeciesHuman
    • SequenceRVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQ YLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDLTAFSDPRQF P
    • Molecular weight37 kDa including tags
    • Amino acids210 to 311
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112260 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Acute myeloid leukemia 1
    • Acute myeloid leukemia 1 protein
    • alpha subunit core binding factor
    • AML 1
    • AML1
    • AML1 EVI 1
    • AML1 EVI 1 fusion protein
    • Aml1 oncogene
    • AMLCR 1
    • AMLCR1
    • CBF alpha 2
    • CBF-alpha-2
    • CBFA 2
    • CBFA2
    • Core binding factor alpha 2 subunit
    • Core binding factor runt domain alpha subunit 2
    • Core-binding factor subunit alpha-2
    • EVI 1
    • EVI1
    • HGNC
    • Oncogene AML 1
    • Oncogene AML-1
    • OTTHUMP00000108696
    • OTTHUMP00000108697
    • OTTHUMP00000108699
    • OTTHUMP00000108700
    • OTTHUMP00000108702
    • PEA2 alpha B
    • PEA2-alpha B
    • PEBP2 alpha B
    • PEBP2-alpha B
    • PEBP2A2
    • PEBP2aB
    • Polyomavirus enhancer binding protein 2 alpha B subunit
    • Polyomavirus enhancer-binding protein 2 alpha B subunit
    • Run1
    • Runt related transcription factor 1
    • Runt-related transcription factor 1
    • RUNX 1
    • Runx1
    • RUNX1_HUMAN
    • SL3 3 enhancer factor 1 alpha B subunit
    • SL3-3 enhancer factor 1 alpha B subunit
    • SL3/AKV core binding factor alpha B subunit
    • SL3/AKV core-binding factor alpha B subunit
    see all
  • FunctionCBF binds to the core site, 5'-PYGPYGGT-3', of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, LCK, IL-3 and GM-CSF promoters. The alpha subunit binds DNA and appears to have a role in the development of normal hematopoiesis. Isoform AML-1L interferes with the transactivation activity of RUNX1. Acts synergistically with ELF4 to transactivate the IL-3 promoter and with ELF2 to transactivate the mouse BLK promoter. Inhibits MYST4-dependent transcriptional activation.
  • Tissue specificityExpressed in all tissues examined except brain and heart. Highest levels in thymus, bone marrow and peripheral blood.
  • Involvement in diseaseNote=A chromosomal aberration involving RUNX1/AML1 is a cause of M2 type acute myeloid leukemia (AML-M2). Translocation t(8;21)(q22;q22) with RUNX1T1.
    Note=A chromosomal aberration involving RUNX1/AML1 is a cause of therapy-related myelodysplastic syndrome (T-MDS). Translocation t(3;21)(q26;q22) with EAP or MECOM.
    Note=A chromosomal aberration involving RUNX1/AML1 is a cause of chronic myelogenous leukemia (CML). Translocation t(3;21)(q26;q22) with EAP or MECOM.
    Note=A chromosomal aberration involving RUNX1/AML1 is found in childhood acute lymphoblastic leukemia (ALL). Translocation t(12;21)(p13;q22) with TEL. The translocation fuses the 3'-end of TEL to the alternate 5'-exon of AML-1H.
    Note=A chromosomal aberration involving RUNX1 is found in acute leukemia. Translocation t(11,21)(q13;q22) that forms a MACROD1-RUNX1 fusion protein.
    Defects in RUNX1 are the cause of familial platelet disorder with associated myeloid malignancy (FPDMM) [MIM:601399]. FPDMM is an autosomal dominant disease characterized by qualitative and quantitative platelet defects, and propensity to develop acute myelogenous leukemia.
    Note=A chromosomal aberration involving RUNX1/AML1 is found in therapy-related myeloid malignancies. Translocation t(16;21)(q24;q22) that forms a RUNX1-CBFA2T3 fusion protein.
    Note=A chromosomal aberration involving RUNX1/AML1 is a cause of chronic myelomonocytic leukemia. Inversion inv(21)(q21;q22) with USP16.
  • Sequence similaritiesContains 1 Runt domain.
  • DomainA proline/serine/threonine rich region at the C-terminus is necessary for transcriptional activation of target genes.
  • Post-translational
    modifications
    Phosphorylated in its C-terminus upon IL-6 treatment. Phosphorylation enhances interaction with MYST3.
    Methylated.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human RUNX1 / AML1 protein images

  • Coomassie Blue stained 12.5% SDS page analysis of ab112260

References for Recombinant Human RUNX1 / AML1 protein (ab112260)

ab112260 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112260.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"