Recombinant Human RUNX1 / AML1 protein (ab112260)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      RVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQ YLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDLTAFSDPRQF P
    • Molecular weight
      37 kDa including tags
    • Amino acids
      210 to 311
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112260 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Acute myeloid leukemia 1
    • Acute myeloid leukemia 1 protein
    • alpha subunit core binding factor
    • AML 1
    • AML1
    • AML1 EVI 1
    • AML1 EVI 1 fusion protein
    • Aml1 oncogene
    • AMLCR 1
    • AMLCR1
    • CBF alpha 2
    • CBF-alpha-2
    • CBFA 2
    • CBFA2
    • Core binding factor alpha 2 subunit
    • Core binding factor runt domain alpha subunit 2
    • Core-binding factor subunit alpha-2
    • EVI 1
    • EVI1
    • HGNC
    • Oncogene AML 1
    • Oncogene AML-1
    • OTTHUMP00000108696
    • OTTHUMP00000108697
    • OTTHUMP00000108699
    • OTTHUMP00000108700
    • OTTHUMP00000108702
    • PEA2 alpha B
    • PEA2-alpha B
    • PEBP2 alpha B
    • PEBP2-alpha B
    • PEBP2A2
    • PEBP2aB
    • Polyomavirus enhancer binding protein 2 alpha B subunit
    • Polyomavirus enhancer-binding protein 2 alpha B subunit
    • Run1
    • Runt related transcription factor 1
    • Runt-related transcription factor 1
    • RUNX 1
    • Runx1
    • RUNX1_HUMAN
    • SL3 3 enhancer factor 1 alpha B subunit
    • SL3-3 enhancer factor 1 alpha B subunit
    • SL3/AKV core binding factor alpha B subunit
    • SL3/AKV core-binding factor alpha B subunit
    see all
  • Function
    CBF binds to the core site, 5'-PYGPYGGT-3', of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, LCK, IL-3 and GM-CSF promoters. The alpha subunit binds DNA and appears to have a role in the development of normal hematopoiesis. Isoform AML-1L interferes with the transactivation activity of RUNX1. Acts synergistically with ELF4 to transactivate the IL-3 promoter and with ELF2 to transactivate the mouse BLK promoter. Inhibits MYST4-dependent transcriptional activation.
  • Tissue specificity
    Expressed in all tissues examined except brain and heart. Highest levels in thymus, bone marrow and peripheral blood.
  • Involvement in disease
    Note=A chromosomal aberration involving RUNX1/AML1 is a cause of M2 type acute myeloid leukemia (AML-M2). Translocation t(8;21)(q22;q22) with RUNX1T1.
    Note=A chromosomal aberration involving RUNX1/AML1 is a cause of therapy-related myelodysplastic syndrome (T-MDS). Translocation t(3;21)(q26;q22) with EAP or MECOM.
    Note=A chromosomal aberration involving RUNX1/AML1 is a cause of chronic myelogenous leukemia (CML). Translocation t(3;21)(q26;q22) with EAP or MECOM.
    Note=A chromosomal aberration involving RUNX1/AML1 is found in childhood acute lymphoblastic leukemia (ALL). Translocation t(12;21)(p13;q22) with TEL. The translocation fuses the 3'-end of TEL to the alternate 5'-exon of AML-1H.
    Note=A chromosomal aberration involving RUNX1 is found in acute leukemia. Translocation t(11,21)(q13;q22) that forms a MACROD1-RUNX1 fusion protein.
    Defects in RUNX1 are the cause of familial platelet disorder with associated myeloid malignancy (FPDMM) [MIM:601399]. FPDMM is an autosomal dominant disease characterized by qualitative and quantitative platelet defects, and propensity to develop acute myelogenous leukemia.
    Note=A chromosomal aberration involving RUNX1/AML1 is found in therapy-related myeloid malignancies. Translocation t(16;21)(q24;q22) that forms a RUNX1-CBFA2T3 fusion protein.
    Note=A chromosomal aberration involving RUNX1/AML1 is a cause of chronic myelomonocytic leukemia. Inversion inv(21)(q21;q22) with USP16.
  • Sequence similarities
    Contains 1 Runt domain.
  • Domain
    A proline/serine/threonine rich region at the C-terminus is necessary for transcriptional activation of target genes.
  • Post-translational
    modifications
    Phosphorylated in its C-terminus upon IL-6 treatment. Phosphorylation enhances interaction with MYST3.
    Methylated.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • Coomassie Blue stained 12.5% SDS page analysis of ab112260

References

ab112260 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112260.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up