Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ13950
    • SpeciesHuman
    • SequenceNPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPS IHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGA
    • Molecular weight37 kDa including tags
    • Amino acids251 to 350

Specifications

Our Abpromise guarantee covers the use of ab112258 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Acute myeloid leukemia 3 protein
    • Alpha subunit 1
    • AML3
    • CBF alpha 1
    • CBF-alpha-1
    • CBFA1
    • CCD
    • CCD1
    • Cleidocranial dysplasia 1
    • Core binding factor
    • Core binding factor runt domain alpha subunit 1
    • Core binding factor subunit alpha 1
    • Core-binding factor subunit alpha-1
    • MGC120022
    • MGC120023
    • Oncogene AML 3
    • Oncogene AML-3
    • OSF 2
    • OSF-2
    • OSF2
    • Osteoblast specific transcription factor 2
    • Osteoblast-specific transcription factor 2
    • OTTHUMP00000016533
    • PEA2 alpha A
    • PEA2-alpha A
    • PEA2aA
    • PEBP2 alpha A
    • PEBP2-alpha A
    • PEBP2A1
    • PEBP2A2
    • PEBP2aA
    • PEBP2aA1
    • Polyomavirus enhancer binding protein 2 alpha A subunit
    • Polyomavirus enhancer-binding protein 2 alpha A subunit
    • Runt domain
    • Runt related transcription factor 2
    • Runt-related transcription factor 2
    • RUNX2
    • RUNX2_HUMAN
    • SL3 3 enhancer factor 1 alpha A subunit
    • SL3-3 enhancer factor 1 alpha A subunit
    • SL3/AKV core binding factor alpha A subunit
    • SL3/AKV core-binding factor alpha A subunit
    see all
  • FunctionTranscription factor involved in osteoblastic differentiation and skeletal morphogenesis. Essential for the maturation of osteoblasts and both intramembranous and endochondral ossification. CBF binds to the core site, 5'-PYGPYGGT-3', of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, osteocalcin, osteopontin, bone sialoprotein, alpha 1(I) collagen, LCK, IL-3 and GM-CSF promoters (By similarity). Inhibits MYST4-dependent transcriptional activation.
  • Tissue specificitySpecifically expressed in osteoblasts.
  • Involvement in diseaseDefects in RUNX2 are the cause of cleidocranial dysplasia (CLCD) [MIM:119600]; also known as cleidocranial dysostosis (CCD). CLCD is an autosomal dominant skeletal disorder with high penetrance and variable expressivity. It is due to defective endochondral and intramembranous bone formation. Typical features include hypoplasia/aplasia of clavicles, patent fontanelles, wormian bones (additional cranial plates caused by abnormal ossification of the calvaria), supernumerary teeth, short stature, and other skeletal changes. In some cases defects in RUNX2 are exclusively associated with dental anomalies.
  • Sequence similaritiesContains 1 Runt domain.
  • DomainA proline/serine/threonine rich region at the C-terminus is necessary for transcriptional activation of target genes and contains the phosphorylation sites.
  • Post-translational
    modifications
    Phosphorylated; probably by MAP kinases (MAPK) (By similarity). Isoform 3 is phosphorylated on Ser-340.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human RUNX2 protein images

  • Coomassie Blue stained 12.5% SDS page analysis of ab112258

References for Recombinant Human RUNX2 protein (ab112258)

ab112258 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112258.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"