Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTMGDKKSPTRPKRQAKPATDEGFWDCSVCTFRNSAEAFKCSICDVRKGT STRKPRINSQLVAQQVAQQYATPPPPKKEKKEKVEKQDKEKPEKDKEISP SVTKKNTNKKTKPKSDILKDPPSEANSIQSANATTKTSETNHTSRPRLKN VDRSTAQQLAVTVGNVTVIITDFKEKTRSSSTSSSTVTSSAGSEQQNQSS SGSESTDKGSSRSSTPKGDMSAVNDESF
    • Amino acids
      1 to 228
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153229 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2410018J24Rik
    • AAP 1
    • AAP1
    • APAP 1
    • APAP-1
    • APAP1
    • Apoptin associating protein 1
    • Apoptin-associating protein 1
    • cb337
    • Death effector domain associated factor
    • Death effector domain-associated factor
    • Death effector domain-associated factor B
    • DED associated factor
    • DED-associated factor
    • DED-associated factor B
    • DEDAF
    • MGC62213
    • RING1 and YY1 binding protein
    • RING1 and YY1 binding protein a
    • RING1 and YY1-binding protein
    • RING1 and YY1-binding protein B
    • Ring1 interactor RYBP
    • RYBP
    • RYBP_HUMAN
    • rybpa
    • wu:fi34f03
    • YEAF 1
    • YEAF1
    • YY1 and E4TF1 associated factor 1
    • YY1 and E4TF1-associated factor 1
    • YY1- and E4TF1/GABP-associated factor 1
    • zgc:153842
    see all
  • Function
    May be implicated in the regulation of the transcription as a repressor of the transcriptional activity of E4TF1. In tumor cell lines, may induce apoptosis.
  • Tissue specificity
    Widely expressed with highest levels in lymphoid tissues and placenta.
  • Sequence similarities
    Contains 1 RanBP2-type zinc finger.
  • Cellular localization
    Nucleus. Cytoplasm. Primarily found in the nucleus.
  • Information by UniProt

Images

  • ab153229 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153229 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153229.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up