Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP34925
    • SpeciesHuman
    • SequenceELQSASAGPSVSLYLSEDEVRRLIGLDAELYYVRNDLISHYALSFSLLVP SETNFLHFTWHAKSKVEYKLGFQVDNVLAMDMPQVNISVQGEVPRTLSVF RVELSCTGKV
    • Molecular weight38 kDa including tags
    • Amino acids54 to 163

Specifications

Our Abpromise guarantee covers the use of ab114531 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 µg/ul. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • D3S3195
    • ERK 3
    • Hydroxyaryl protein kinase
    • JTK 5
    • JTK 5A
    • JTK5
    • JTK5A
    • JTK5A protein tyrosine kinase
    • receptor like tyrosine kinase
    • receptor like tyrosine kinase precursor
    • Ryk
    • RYK 1
    • RYK_HUMAN
    • RYK1
    • Tyrosine protein kinase RYK
    • Tyrosine protein kinase RYK precursor
    • Tyrosine-protein kinase RYK
    • Vik
    see all
  • FunctionMay be a coreceptor along with FZD8 of Wnt proteins, such as WNT1, WNT3, WNT3A and WNT5A. Involved in neuron differentiation, axon guidance, corpus callosum establishment and neurite outgrowth. In response to WNT3 stimulation, receptor C-terminal cleavage occurs in its transmembrane region and allows the C-terminal intracellular product to translocate from the cytoplasm to the nucleus where it plays a crucial role in neuronal development.
  • Tissue specificityObserved in all the tissues examined.
  • Sequence similaritiesBelongs to the protein kinase superfamily. Tyr protein kinase family.
    Contains 1 protein kinase domain.
    Contains 1 WIF domain.
  • DomainThe extracellular WIF domain is responsible for Wnt binding.
  • Post-translational
    modifications
    Proteolytically cleaved, in part by presenilin, in response to WNT3 stimulation. Cleavage occurs during neuronal differentiation.
  • Cellular localizationMembrane. Nucleus. Cytoplasm. In cells that have undergone neuronal differentiation, the C-terminal cleaved part is translocated from the cytoplasm to the nucleus.
  • Information by UniProt

Recombinant Human RYK protein images

  • 12.5% SDS-PAGE showing ab114531 at approximately 37.73kDa stained with Coomassie Blue.

References for Recombinant Human RYK protein (ab114531)

ab114531 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114531.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"