Recombinant Human S100 alpha 2 protein (ab104821)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMCSSLEQALAVLVTTFHKYSCQEGDKFKLS KGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLA LITVMCNDFFQGCPDRP
    • Molecular weight
      13 kDa including tags
    • Amino acids
      2 to 98
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104821 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab104821 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • CAN19
    • MGC111539
    • Protein S 100L
    • Protein S-100L
    • Protein S100 A2
    • Protein S100-A2
    • Protein S100L
    • S100 A2
    • S100 calcium binding protein A2
    • S100 calcium-binding protein A2
    • S100A2
    • S100L
    • S10A2_HUMAN
    see all
  • Function
    May function as calcium sensor and modulator, contributing to cellular calcium signaling. May function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes. May also play a role in suppressing tumor cell growth.
  • Tissue specificity
    A subset of epithelial cells including normal human mammary epithelial cells and keratinocytes.
  • Sequence similarities
    Belongs to the S-100 family.
    Contains 2 EF-hand domains.
  • Developmental stage
    Preferentially expressed in normal human mammary epithelial cells as opposed to tumor-derived ones. The level of S100L was shown to correlate inversely with tumor progression.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab104821.

References

ab104821 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab104821.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up