Recombinant Human S100 alpha 2 protein (ab104821)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP29034
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMCSSLEQALAVLVTTFHKYSCQEGDKFKLS KGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLA LITVMCNDFFQGCPDRP
    • Molecular weight13 kDa including tags
    • Amino acids2 to 98
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104821 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab104821 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • CAN19
    • MGC111539
    • Protein S 100L
    • Protein S-100L
    • Protein S100 A2
    • Protein S100-A2
    • Protein S100L
    • S100 A2
    • S100 calcium binding protein A2
    • S100 calcium-binding protein A2
    • S100A2
    • S100L
    • S10A2_HUMAN
    see all
  • FunctionMay function as calcium sensor and modulator, contributing to cellular calcium signaling. May function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes. May also play a role in suppressing tumor cell growth.
  • Tissue specificityA subset of epithelial cells including normal human mammary epithelial cells and keratinocytes.
  • Sequence similaritiesBelongs to the S-100 family.
    Contains 2 EF-hand domains.
  • Developmental stagePreferentially expressed in normal human mammary epithelial cells as opposed to tumor-derived ones. The level of S100L was shown to correlate inversely with tumor progression.
  • Information by UniProt

Recombinant Human S100 alpha 2 protein images

  • 15% SDS-PAGE analysis of 3µg ab104821.

References for Recombinant Human S100 alpha 2 protein (ab104821)

ab104821 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104821.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"