Recombinant Human S100 alpha 6 protein (ab104360)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MKHHHHHHASMACPLDQAIGLLVAIFHKYSGREGDKHTLSKKE LKELI QKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALI YNE ALKG
    • Molecular weight
      11 kDa including tags
    • Amino acids
      1 to 90
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104360 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form
    Lyophilised
  • Additional notes
    Please filter the product by an appropriate sterile filter before using it in the cell culture.
    Store lyophilized protein at –20°C. Lyophilized protein remains stable until the expiry date when stored at –20°C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80°C for long term storage. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after one week at 4°C.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    Preservative: None
    Constituents: 50mM Sodium chloride, 20mM Tris, pH 7.5

  • Reconstitution
    Add deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely. Product is not sterile!

General Info

  • Alternative names
    • 2A9
    • 5B10
    • CABP
    • CACY
    • Calcyclin
    • Growth factor inducible protein 2A9
    • Growth factor-inducible protein 2A9
    • MLN 4
    • MLN4
    • OTTHUMP00000015472
    • OTTHUMP00000015473
    • PRA
    • PRAGrowth factor inducible protein 2A9
    • Prolactin receptor associated protein
    • Prolactin receptor-associated protein
    • Protein S100 A6
    • Protein S100-A6
    • S100 A6
    • S100 calcium binding protein A6
    • S100 calcium binding protein A6 (calcyclin)
    • S100 calcium-binding protein A6
    • S100A6
    • S10A6_HUMAN
    see all
  • Function
    May function as calcium sensor and modulator, contributing to cellular calcium signaling. May function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes such as the reorganization of the actin cytoskeleton and in cell motility. Binds 2 calcium ions. Calcium binding is cooperative.
  • Sequence similarities
    Belongs to the S-100 family.
    Contains 2 EF-hand domains.
  • Post-translational
    modifications
    The N-terminus is blocked.
  • Cellular localization
    Nucleus envelope. Cytoplasm. Cell membrane.
  • Information by UniProt

Images

  • 14% SDS-PAGE showing ab104360 at approximately 11.42kDa:
    Lane 1: M.W. marker – 14, 21, 31, 45, 66, 97 kDa
    Lane 2: reduced and heated sample, 5µg/lane.
    Lane 3: non-reduced and non-heated sample, 5µg/lane.

References

ab104360 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab104360.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up