Recombinant Human S100 alpha 6 protein (ab104360)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP06703
    • SpeciesHuman
    • SequenceMKHHHHHHASMACPLDQAIGLLVAIFHKYSGREGDKHTLSKKE LKELI QKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALI YNE ALKG
    • Molecular weight11 kDa including tags
    • Amino acids1 to 90
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104360 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • FormLyophilised
  • Additional notesPlease filter the product by an appropriate sterile filter before using it in the cell culture.
    Store lyophilized protein at –20°C. Lyophilized protein remains stable until the expiry date when stored at –20°C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80°C for long term storage. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after one week at 4°C.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    Preservative: None
    Constituents: 50mM Sodium chloride, 20mM Tris, pH 7.5

  • ReconstitutionAdd deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely. Product is not sterile!

General Info

  • Alternative names
    • 2A9
    • 5B10
    • CABP
    • CACY
    • Calcyclin
    • Growth factor inducible protein 2A9
    • Growth factor-inducible protein 2A9
    • MLN 4
    • MLN4
    • OTTHUMP00000015472
    • OTTHUMP00000015473
    • PRA
    • PRAGrowth factor inducible protein 2A9
    • Prolactin receptor associated protein
    • Prolactin receptor-associated protein
    • Protein S100 A6
    • Protein S100-A6
    • S100 A6
    • S100 calcium binding protein A6
    • S100 calcium binding protein A6 (calcyclin)
    • S100 calcium-binding protein A6
    • S100A6
    • S10A6_HUMAN
    see all
  • FunctionMay function as calcium sensor and modulator, contributing to cellular calcium signaling. May function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes such as the reorganization of the actin cytoskeleton and in cell motility. Binds 2 calcium ions. Calcium binding is cooperative.
  • Sequence similaritiesBelongs to the S-100 family.
    Contains 2 EF-hand domains.
  • Post-translational
    modifications
    The N-terminus is blocked.
  • Cellular localizationNucleus envelope. Cytoplasm. Cell membrane.
  • Information by UniProt

Recombinant Human S100 alpha 6 protein images

  • 14% SDS-PAGE showing ab104360 at approximately 11.42kDa:
    Lane 1: M.W. marker – 14, 21, 31, 45, 66, 97 kDa
    Lane 2: reduced and heated sample, 5µg/lane.
    Lane 3: non-reduced and non-heated sample, 5µg/lane.

References for Recombinant Human S100 alpha 6 protein (ab104360)

ab104360 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104360.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"