Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP06703
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMACPLDQAIGLLVAIFHKYSGREGDKHTLS KKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGAL ALIYNEALKG
    • Molecular weight12 kDa including tags
    • Amino acids1 to 90
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104645 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab104645 is purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 30% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 2A9
    • 5B10
    • CABP
    • CACY
    • Calcyclin
    • Growth factor inducible protein 2A9
    • Growth factor-inducible protein 2A9
    • MLN 4
    • MLN4
    • OTTHUMP00000015472
    • OTTHUMP00000015473
    • PRA
    • PRAGrowth factor inducible protein 2A9
    • Prolactin receptor associated protein
    • Prolactin receptor-associated protein
    • Protein S100 A6
    • Protein S100-A6
    • S100 A6
    • S100 calcium binding protein A6
    • S100 calcium binding protein A6 (calcyclin)
    • S100 calcium-binding protein A6
    • S100A6
    • S10A6_HUMAN
    see all
  • FunctionMay function as calcium sensor and modulator, contributing to cellular calcium signaling. May function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes such as the reorganization of the actin cytoskeleton and in cell motility. Binds 2 calcium ions. Calcium binding is cooperative.
  • Sequence similaritiesBelongs to the S-100 family.
    Contains 2 EF-hand domains.
  • Post-translational
    modifications
    The N-terminus is blocked.
  • Cellular localizationNucleus envelope. Cytoplasm. Cell membrane.
  • Information by UniProt

Recombinant Human S100 alpha 6 protein images

  • 15% SDS-PAGE showing ab104645 at approximately 12.3kDa (3µg).

References for Recombinant Human S100 alpha 6 protein (ab104645)

This product has been referenced in:
  • Lorenzi R  et al. Soluble form of receptor for advanced glycation end-products (sRAGE): do sRAGE ligands or anti-sRAGE auto-antibodies interfere with sRAGE quantification? Ann Clin Biochem N/A:N/A (2013). Read more (PubMed: 23982266) »

See 1 Publication for this product

Product Wall

There are currently no Abreviews or Questions for ab104645.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"