Recombinant Human S100 beta protein (ab55570)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence 1
    • Species
      Human
    • Sequence
      SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQ EVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
    • Amino acids
      2 to 92
    Amino Acid Sequence 2
    • Species
      Human
    • Sequence
      SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQ EVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
    • Amino acids
      2 to 92

Specifications

Our Abpromise guarantee covers the use of ab55570 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 95 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

General Info

  • Alternative names
    • NEF
    • Protein S100 B
    • Protein S100-B
    • S 100 calcium binding protein beta chain
    • S 100 protein beta chain
    • S-100 protein beta chain
    • S-100 protein subunit beta
    • S100
    • S100 calcium binding protein beta (neural)
    • S100 calcium-binding protein B
    • S100 protein beta chain
    • S100B
    • S100B_HUMAN
    • S100beta
    see all
  • Function
    Weakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer. Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites. Binds to and initiates the activation of STK38 by releasing autoinhibitory intramolecular interactions within the kinase. Interaction with AGER after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling.
  • Tissue specificity
    Although predominant among the water-soluble brain proteins, S100 is also found in a variety of other tissues.
  • Sequence similarities
    Belongs to the S-101 family.
    Contains 2 EF-hand domains.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • ab55570 on SDS-PAGE

References

ab55570 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab55570.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up