Recombinant Human S100 beta protein (ab55570)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence 1
    • Species
      Human
    • Sequence
      SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQ EVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
    • Amino acids
      2 to 92
    Amino Acid Sequence 2
    • Species
      Human
    • Sequence
      SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQ EVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
    • Amino acids
      2 to 92

Specifications

Our Abpromise guarantee covers the use of ab55570 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 95 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

General Info

  • Alternative names
    • NEF
    • Protein S100 B
    • Protein S100-B
    • S 100 calcium binding protein beta chain
    • S 100 protein beta chain
    • S-100 protein beta chain
    • S-100 protein subunit beta
    • S100
    • S100 calcium binding protein beta (neural)
    • S100 calcium-binding protein B
    • S100 protein beta chain
    • S100B
    • S100B_HUMAN
    • S100beta
    see all
  • Function
    Weakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer. Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites. Binds to and initiates the activation of STK38 by releasing autoinhibitory intramolecular interactions within the kinase. Interaction with AGER after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling.
  • Tissue specificity
    Although predominant among the water-soluble brain proteins, S100 is also found in a variety of other tissues.
  • Sequence similarities
    Belongs to the S-101 family.
    Contains 2 EF-hand domains.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Recombinant Human S100 beta protein images

  • ab55570 on SDS-PAGE

References for Recombinant Human S100 beta protein (ab55570)

ab55570 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab55570.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up