Recombinant Human S100 Calcium Binding Protein A13 (ab105573)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ99584
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAAEPLTELEESIETVVTTFFTFARQEGRK DSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLI GELAKEIRKKKDLKIRKK
    • Molecular weight14 kDa including tags
    • Amino acids1 to 98
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab105573 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab105573 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, pH 8

General Info

  • Alternative names
    • Protein S100 A13
    • Protein S100-A13
    • S100 calcium binding protein A13
    • S100 calcium-binding protein A13
    • S100a13
    • S10AD_HUMAN
    see all
  • FunctionPlays a role in the export of proteins that lack a signal peptide and are secreted by an alternative pathway. Binds two calcium ions per subunit. Binds one copper ion. Binding of one copper ion does not interfere with calcium binding. Required for the copper-dependent stress-induced export of IL1A and FGF1. The calcium-free protein binds to lipid vesicles containing phosphatidylserine, but not to vesicles containing phosphatidylcholine.
  • Tissue specificityExpressed in heart and skeletal muscle.
  • Sequence similaritiesBelongs to the S-100 family.
    Contains 2 EF-hand domains.
  • Cellular localizationCytoplasm. Secreted. Secretion is mediated by exposure to stress and requires copper ions.
  • Information by UniProt

Recombinant Human S100 Calcium Binding Protein A13 images

  • 15% SDS-PAGE analysis of ab105573 (3ug)

References for Recombinant Human S100 Calcium Binding Protein A13 (ab105573)

ab105573 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab105573.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"